SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022786 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022786
Domain Number 1 Region: 886-1090
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-47
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022786
Domain Number - Region: 283-336
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000143
Family Motor proteins 0.014
Further Details:      
 
Domain Number - Region: 84-116,144-298
Classification Level Classification E-value
Superfamily ARM repeat 0.00141
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022786   Gene: ENSMODG00000018272   Transcript: ENSMODT00000023189
Sequence length 1283
Comment pep:novel chromosome:BROADO5:4:85905286:85991474:1 gene:ENSMODG00000018272 transcript:ENSMODT00000023189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTTVDPRILSIAAEVTESPEQNVPVILLKLKEIINSAPLGSSELKKIKQDIYCYNLIQ
YCLLVLRKDGAKIQGGWVTISQLAQILSQCCVGLEPKEEAEEFYNKLLPSAADNFLTLGR
RLQKCYISAVKDEEKDEFLWHFQSVIDSLCWLLGGHIQLTKYVLQSDHFLHLLQTDDIKT
GSSIMTVLQNILQVKSGDFLMIKEKAFHSILDELIFKLSSSTCLVIGSAAIKLLLLLASS
HPEIIMLLNSRYTGLKSILNKQCSGKEIDQEVKQLFSLLHSEVCHEDQKFYQAACKIQAA
WKGFQTRKRMKKLPYAVTTLQRNFRNKREKQLLKLKKQKEEKDLKLQLQLQRQRAMRISR
ECRLNLLEIVHPGQMGKYIQEMEEKSALVIQKYWRGYRERKNFCQQKQSLQEYKAAVILQ
RAALTFLRKCHKRKKMSNSWQGLPGLTDARRMELKQHVDNYIKRHSASEMSHVASRELHT
EAQERLGHYFLGRALEERAQQRREALQAQISTNIEQLMSAPNLRETTGQEPELFISRSRP
VATRAKQAHLATLMERQAPWWKKLEDEFTDLKLRTLAFGDRSQLLCEPVGLNLPTWKTKP
QATVENPESLQAVNDCVFDRGGKEDAMCLAFGSLCSTYPFSASAHLHKSPLSCTPIVAVK
SPSWSQEPQDVGSTTLDNNSRFVEAPIATQICWKEMKDKIAKDTHLVEWTLSSNCHCSSL
NNPLESSKSPQECQPQPHFSGSTPMTNNWKKQLELKSAATIHQHMKKWQTKKNPELPGVP
HGWKLDENNCSLPAKQHWNNMDHLSTGNQVTGLCEGQDENEPCGDQEPGPALRAGAAEAE
QEDPGLESALAPSWRSQASTVSNSPEAHCTDCREEKEALSPGHRSLCGQCTKLRWERKQA
VLEFIQTEASYGENLRVIKEQFQLPMQSAGLLSPGQLLAVFSNIQELIDLNEKFLESLKE
EIAEALSQGDDDLMNVCVGGIFLKYVNMLPAFQTYCLQQASSISTLSTLEKEKELLRIFL
HASQTNNTALRRMNLRSFLMAPLQRITKYPLLLSRITQATATFHPDYSHLCEATSHLASY
LEHINRKTRQEGSLPWALRPFRQDVCHHHEAIAAIDRRELALKTLGWLWEETRFVMEGGL
QLAQLPDGPWTRKGSRTLKFQTLQVILMARLQKSAEIGSRHGSLGQGPVGDAALVLIRDK
SHGKLNLVRSPVRLGQCVVSADPVCKTFELLEIQQGALILRDEDYARTQLWLYHIRVYAR
QLGSWKRRRNALPNIMINIPNHP
Download sequence
Identical sequences F6Q714
ENSMODP00000022786 ENSMODP00000022786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]