SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023558 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023558
Domain Number 1 Region: 288-373
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000265
Family I set domains 0.05
Further Details:      
 
Domain Number 2 Region: 476-555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000506
Family I set domains 0.054
Further Details:      
 
Domain Number 3 Region: 185-270
Classification Level Classification E-value
Superfamily SEA domain 0.00000719
Family SEA domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023558
Domain Number - Region: 990-1299
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00128
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023558   Gene: ENSMODG00000018882   Transcript: ENSMODT00000023976
Sequence length 1347
Comment pep:novel chromosome:BROADO5:2:292884473:292988909:-1 gene:ENSMODG00000018882 transcript:ENSMODT00000023976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPRRPVFCFLFLIVIYSSQAALNLSLESIVHSLINRSHELDSNDYRAESLRHKRAVAT
SSPAPEEYEIEIEISFENTSLLESFKAYYKNLSFPIQVINTNLSTDILSMEITTVCRSSG
NEMLCSCESGYKWLPEVCLSNLTCQNYQHSAPEDCNCLKELPARGPYCQQVILKDITLRM
SVKLSMDFQDDLRNSSSALYRSYKTDLERAFRQGYRILPGFKSVVITGFSPGSIDVAYNV
KTSKPTPAQMNEANEQVKRLINSTYKMDHLSFEASLDNETKFSIVPEIIYEGDTVMMKCE
NEVQSTNVTWRHVERSTDIQNSSEFSIYTYLNHQVSVSILTIHNISLIDAGEYLCSLTYD
IFYYEGRKKVNVISTEFVASEDLKVMCDNNPVSLSCCSGKDFNLSNIEWNQEGLINIPGI
SSIDSGCSKLTIKADGTQCLSGSAGTEVFYICSFLSGYGANSSKKIKVTFTSVANITVTA
DLIAISEGQNFSIKCISDVSSYDSVFWNTSAGTRINPKFYVTTTCNDRAESVLTVNTATR
EWNGTYHCIFRYKNSFSIATKDVTVYPLPLKHDILLDPLEADVPCGGFCHLRCCINEAGD
YRVTFQIDGLSFPAVKKAQGNRVCYGYSLNTTIWCSKTVQPFCNFVNSVGESVQSTTMTL
YLVPEENITCQDSNIGNGKAGKMIQKLCQFSDIPNNSGHGVGGTITYICEGSTWKVKKND
CIAAPINNLLGLTKALLMSPEQEEKLLTYLQDLSSSTEKVENEIKSSPGNLKAIITILEL
LSTVPTQVTSDMMKHVLSTVNVILGKPILNTWQILHQQQANESSRLLDSIERFSRVLHEG
ISAIPSITQVNVQMRGLVTTAGQVTDYDQHFVFPNSNLWGHVIIDRHQIESLQPNSSIVT
LAYPTLKAILPQGTLDKNIVNGLVMTTTVSQGVTKPFRISMKFKKNDLSLVAPQCVFWNF
HISNHTGGWDNTGCFVDQVKEESVLCTCNHLTSFSILMSPDSPDSNSLVQILLDIISYIG
LGFSILSLAACLIIEAFVWKSVTKNRTSYMRHVCIVNIAASLLIADSWFIVSAVIHDQRY
LLSETACVASTFFIHFFYLSVFFWMLTLGLMLFYRLVFILHDTSKSIQKAIAFSLGYGCP
LVISIITVGVTQPRNVYMRKNACWLNWDDTKALLAFVIPALIIVVINVTITFVVITKILR
PSIGDKPSIQEKNSLFQITKSIGVLTPLLGLTWGFGLATVFQESSAVFHIVFTLLNAFQG
LFILLFGCLWDKKVQEALLHKFSLSRWSSQHTKSTSLASSTPVFSMSSPISRRFNNLFGK
TGTYNVSPPETTISSTENSSSAYSLLN
Download sequence
Identical sequences F7DA49
ENSMODP00000023558 XP_007484092.1.35504 XP_007484093.1.35504 XP_007484094.1.35504 XP_007484095.1.35504 XP_007484096.1.35504 XP_016286604.1.35504 ENSMODP00000023558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]