SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025181 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025181
Domain Number 1 Region: 7-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-30
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 95-123
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000541
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025181
Domain Number - Region: 139-186
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0157
Family PspA lactotransferrin-binding region 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025181   Gene: ENSMODG00000006493   Transcript: ENSMODT00000025627
Sequence length 217
Comment pep:novel chromosome:BROADO5:2:444143878:444571466:1 gene:ENSMODG00000006493 transcript:ENSMODT00000025627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLD
KESAQNCSRALNNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSQCYECGETGHLSYAC
PKNVLGERDPPKKKEKKKRKKIIKLEEEIEEVDKSEGEGEDPALDSLSQAIAFQQAKIEE
DQQRWKPCASEPSTSDDSRRPRIKKSAYFSDEEELSD
Download sequence
Identical sequences F7D5E7
ENSMODP00000025181 ENSMODP00000025181 13616.ENSMODP00000025181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]