SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025258 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025258
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily Immunoglobulin 4.01e-22
Family V set domains (antibody variable domain-like) 0.00014
Further Details:      
 
Domain Number 2 Region: 190-302
Classification Level Classification E-value
Superfamily Immunoglobulin 8.14e-21
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 
Domain Number 3 Region: 277-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000132
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025258   Gene: ENSMODG00000020195   Transcript: ENSMODT00000025707
Sequence length 396
Comment pep:novel chromosome:BROADO5:5:294813897:294847118:-1 gene:ENSMODG00000020195 transcript:ENSMODT00000025707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEFTVIGPQQPIVAFVGTEVTLPCHLHPQLDATYMEVVWFHGQHSNVVHRYKYAQDYLK
YQHPDYRGRTEFLRENISHGSVALRLHQIRPSDEGKYRCFFESPSHYNEAEFQLKVIGEC
AKGIKVGGLGVKGVWSLENSSVHSNVMKSKSLNEPSFNYLLNQFDNFYLLGPRHKDHCLL
FHLYWSTASFTVIGPQQPIVALVGTEVTLPCYLHPQWDATYMEVIWFHGQNSSLVHHYKN
AQEFLKYQHLDYRGRTEFLRENIYHGSVALRLHQIRPSDEGKYRCFFESPSHYHEAEFQV
NVTGIGSAPHIYIDGVGYKRLHLVCTSTGWYPEPEVQWKNHKEEPLSGGSVTMKKVNGLF
SVETSITVSANSKENVSCVIGSPHQSQKKEAHIAWS
Download sequence
Identical sequences F7G8B1
13616.ENSMODP00000025258 ENSMODP00000025258 ENSMODP00000025258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]