SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025565 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025565
Domain Number 1 Region: 1834-2111
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.43e-69
Family MHCK/EF2 kinase 0.00066
Further Details:      
 
Domain Number 2 Region: 19-111
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 1775-1849
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000464
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025565   Gene: ENSMODG00000020435   Transcript: ENSMODT00000026017
Sequence length 2156
Comment pep:novel chromosome:BROADO5:3:247132279:247324405:1 gene:ENSMODG00000020435 transcript:ENSMODT00000026017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWHERMTDSKPAPRSALRFLSTLPSQKVPEKSDLVLRCIISGQPKPEVTWYKNGHAISES
NIVSNYEILENQYIHMLHLYSCTKNDAAVYQISAQNCFGMICCSAFIEVECLSENPQLNP
NLKEDAARGWKNKTEMCEVDNSPQIDEKEQLFQEERNVIEDFSTLSGSSSPKFRGSCLSQ
LQSNNHKESPSLEKDTGVKSTIQTQEDCSNHNYTEENAFDLLSLKGRDEVDTLEKCGNGL
IHSKPSRLIDDHMASYDEVLPPSHRDPKIQKYISFSMALPEETASIYHVNSSTTKQHVSP
EISSEDSDTDFELCPEIKLTCTEEFSDDDLEYLECSDVMTDYSNAIWQEELRGNDPIFLL
ERDDEETKFREGCLGGCEHFHSEMACQCQVSDNIVPMDTTIGFCGHHSKLQEVAGRSSLP
TYNQSILQPGMTLTLRHPQDETSPVKDQERYKLPVTSTANDSDQPGMKGENADSHQAEAY
FSIDNLMDMDKTPGEMMPQTRELEKPVTNQPEENPAEKSAGGDLLRKKGSQKLVRARRPG
AKGKPRKLNTNLQEKATDGSLSLPGPGEVSNLELSQGNRRESFHEEAEAIHLNSQFHGGE
YAILTQAQQETETLPTPTESLSIEGETDLKRKGKCIEGLLETDQMAKQHAHPQVQKEESS
KKGTTNTTKSHLQAFSESMIDSESLGKVSALSGTITSSLSSQQSTSEGDGSLAHHRELES
CSPGPQHHEKEDQESNLCQLASPREDGPYEQTSSEASHENLLDCELLAHYQHVSDADLGE
QESLYIALAEASYAVLTAEQSFSVPRDGEEPLDMAPHETDDTKTGCSPKYFPSSMPCNDY
LSQENCPMGSQLADRQHETSDLCLISDMTKEQFSQAQDAETPCPTCENREAGDANTAPYS
LSISMGNSLEGAYERDTNENKIGDKNSVKELTTILDGDQEKLSPSNLVNAWEAQISTEKD
CLSQLQEEGVAALLGIEDEAGTSLCNMIVEHHEKSSNEMLTENIRGYQGPSDGEETSALG
TVVKGHQAKYLALSIAQNNHLDRAKEHLPEAPAGSTVQFPSDEQSALAGNDWTVNAAEQL
ILEDPLGTAAHLPHPQLLQREDFLSNSLGAIADGLTIESEAPESAVDRSWAENCQGEERE
SEQNLCKEIQPQQGSFSGEDSLQDSFYAIAAAWGQSSPLPLKYSTDNFEEERGNLGLPSA
RVAVANEEGERQTSWKVRSSLQNLLEEAKENSADGNQGDYELGEGQKALALADLVSEPSP
PMQIVDLESKVSSMIWDNACVISEKPEAENSIQKLDTSETDKSTRSNQSNSTIVCGGREI
QEKKEVGNNVGFCIPSLQYLKDSNILESSVDPINEKETCVEISQFKGGLDVVSEISEKKN
IDGVSKIQEKDQSREVHSLLTQFLTHPEIMESSVDSTNETGVLECVGTGKLVTSESTLGV
IPEGRNLNKERYSQKLKVKTSLSQVPCLKEVEHLEEGIPCVGHERQSQEGMERDLGEPVH
KVQDSATEWIAGSSILSNSLVGLATDTSHERETNSGISQTQDMSVSSVELKQHEQICSDS
KACQNTESECTKYLSPNLPPTSVPFGFPLTSFQEGEGTHFAMDGKIEELTTGEPKATDSL
GSPIETLAFLPAESVSKTSPVCKDQQPSNHCQKSSLQGIVQKAKEERKHHHMMPPKSKVP
ETLAEEGNKKQEMSGTGHLAEGVKKKILSKVAALKMRLEEKERARKNSIFSKKIPKPETL
TQNEEKKDPKRQSCKKECKAPVLLKNIQAEIFPDHSGNIKLSCQFAEIHEDSTISWTKDS
KLIAKVQRSAGDKSTVSLAIVQASKKDQGLYYCCLRNGYGKVTAEFNLTSEVLGQLSSHQ
DIKGFEEIEFSQLIFREDFISDSYFGDNLHGQIATEELHFGEGVHRKAFRSKVMQGLTPV
FSPGHACVLKVHNAIAYGTKNNDELVQKNYKLAAQECYVQNTARQYAKIYAAEAQPLEGF
GEVPEIIPIFLIHRPKNNIPYATVEEELIGEFVKYSIRDGKEINFLRRESEAGQKCCTFQ
HWVYQKTSGSLLVTDMQGVGMKLTDVGIATLAKGYKGFKGNCSMTFIDQFKALHQCNKYC
EMLGLKSLQTNNQKQRKPIMGRGKVQPPTTPAKKAGANATVEKRTDSTVKSPASRE
Download sequence
Identical sequences F7AR66
ENSMODP00000025565 ENSMODP00000025565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]