SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025953 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025953
Domain Number 1 Region: 169-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-78
Family Eukaryotic proteases 0.0000378
Further Details:      
 
Domain Number 2 Region: 41-160
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000157
Family SEA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025953   Gene: ENSMODG00000020752   Transcript: ENSMODT00000026417
Sequence length 420
Comment pep:novel chromosome:BROADO5:5:155075565:155138860:1 gene:ENSMODG00000020752 transcript:ENSMODT00000026417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPVVPVRKRSCLEPWVIGLITFISLIVLAVCIGLIVHYVRYNTLKPYNYYSTLSFTSD
KYYHEFDKEATTNFTEMSQRIESIVKSAFYDSILRKQFIKSQVIKFSPQEPGVVAHMLMI
FRFPSTQTPESIKKTIQRVLHEKLQHATGPPQVDPSSVKMVHINKTETDQYLNSCCGTRR
GMSSGTSLRIVGGEEVEQEGEWPWQASLRWNGEHRCGATLINATWLVSAAHCFRNYKDPA
NDCFGVTLRPPKERRGIRRIIVHENYKYPSHEYDIAVLQLDRPVPYTNAVHRVCLPDASY
KVKAGDAAYVTGFGAMRNDGTSVNNLRQVKVNIIDTKICNEPQIYNNDITAGMICAGFLT
GGKDACQGDSGGPLVSPNSREIWYLIGIVSWGDECAQRNKPGVYTLVPFFREWIASKTGV
Download sequence
Identical sequences F6ZZD6
ENSMODP00000025953 ENSMODP00000025953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]