SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026043 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026043
Domain Number 1 Region: 294-364,493-550
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000157
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 203-295
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000277
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 92-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000871
Family I set domains 0.063
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026043
Domain Number - Region: 401-468
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00511
Family C1 set domains (antibody constant domain-like) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026043   Gene: ENSMODG00000020822   Transcript: ENSMODT00000026508
Sequence length 772
Comment pep:novel chromosome:BROADO5:4:377717496:377723076:-1 gene:ENSMODG00000020822 transcript:ENSMODT00000026508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NHPVSGASGASSAALDAAPSLGRGQSSSPSAAPGQSASSPGLRGNLTVLSGKASLTTGWS
GHASSPPVRDGTAGPLQVPSGWSIPRGAGGPLSVLVGAPISLHLAPAPALGPPSPLVVWR
RGRTVLAAGTLGIEDSPPSLAPAYQARLRFDQATGALELRQAELEDSGHYTAEVIHAGRE
RELREVTVRVYEPLPQLAVIPADPVTEEGATALRLRCVGARPGQGQLSWSQDGRPLGAES
GDGDGSARLRPDGIDLVIARPKRTDQANYTCRVQSPFGARQATTAVTVLYGPDPPVITIS
SDQDESPAHYVSVGSNVTLRCNAASRPPAELSWSLADPREAAVPAGPRLLLPGVGAAHTG
AYACLAANPRTGLRRRGLLNLTVAAPPPGSPRCSLQGSPGDRSLLLRCTWPGGVPGASVQ
WTGLPRDVPAGPAPSSLLVSVPAGPQLSGVTFTCLGRHLAATRSCSVTPKAPQEVLLKLE
TDGSRSSEALVTLEATGCPPPARVSWAREGRPLAPGGGSRLKLSPDGRRLLLGNFSLDHD
VGNYSVLCSGALRAGGDRITLTGPSISSWRLQPSDGAAVLTWDVERGCVISGFEVQARTE
RPEAGAIGLSGGAWTSLLLLGPRERSAVVILPSQPPGPWKLRVLPTLGGQPGTPSSSQSY
RAGFILSPGAIAGIVLGTLLGLSLLAALLILLGCCACRLRGEQRIAKKPMIFPPATCTPE
KTQNVTPVGTPQPALNGFATEPSPTWACPVVVPSQVSAAKGAPRTVRAATQV
Download sequence
Identical sequences F6RM47
ENSMODP00000026043 ENSMODP00000026043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]