SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026819 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026819
Domain Number 1 Region: 899-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 3.81e-39
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 2 Region: 598-788
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-36
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 467-565
Classification Level Classification E-value
Superfamily Fibronectin type III 3.5e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 1539-1626
Classification Level Classification E-value
Superfamily Immunoglobulin 5.45e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 236-323
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000092
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 378-462
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000122
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 1321-1403
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000646
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 1122-1185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000258
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 1442-1502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000204
Family I set domains 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026819
Domain Number - Region: 1221-1297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000309
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026819   Gene: ENSMODG00000021465   Transcript: ENSMODT00000027300
Sequence length 1645
Comment pep:novel chromosome:BROADO5:3:268573875:268754007:-1 gene:ENSMODG00000021465 transcript:ENSMODT00000027300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPFYQKYHEHYDRGYRSKDLQSTMSQYQQEKKSSAIYTHGSTAYSHMSSAHRQASEAY
DSSASRQGSHSYSLGSSAYSLGSEVSHKASSAYDYGYDLGLTDSALMIEDYSSKSSPKAK
RVKKSLVSGEEKENQPKDYVVPIFSGRQVHVNGITDTEEERIKEAAAYVARRNLMATGEG
ITTTKQSTVSSQQEELFEKKSRKVAIREKADRLVLRKTLEETEEFHRKLNEDSLLHAPEF
VIKPRSHTVWEKQNVRLHCSVSGWPEPRLTWYKNHVPINVHANPGKYIIESRYGMHYLEI
NASTSLHKLTSFRYTAQNVDGELSCFLVSVSRYKGEYDETRFHAGASTMPLSFGVTPYGF
ASKFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEVQWYRNGTLVSPSKWVQTQ
WSGDRATLTFSHLNKEDEGLYTLRVRMGEYYEQYSAYVFVRDADAEIAGAPASPLDVVCL
DANKDYVIISWKQPAVDGGSPILGYFIDKCEVGTDIWSQCNDTPVKFARFPITGLIEGRS
YIFRVRAVNKTGISIPSRVSEPVAALDPVDRARLKSQPSAPWTGQIIVTEEEPAEGVVPG
PPTDLSVTESTRSYVVLSWKPPGQRGHEGIMYFVEKCVADTENWQRVNTEIPVKSPRFAL
FDLAEGKSYRFRVRCSNSAGVGEPSEATDVTVVGDKLDIPKAPGRIIPSRNTDTSVVVTW
EESKDAKELVGYYIESSVVGSGQWEPCNNNPVKGSRFICHGLVNGQNYIFRVRAVNAAGL
SEYSQDSEAIEVKAAIGGGVSQGVWPELNDKAGGLTDYRGGMHEASRSTSKKAALLDSGD
KFNQYTPPSSSDRLDKAEVSKVSEKVQDKQEPPPAETTVQEALAPLAEPQKAADQGKTAP
SPPYDITCLESFRDSMVLGWKQPEKTGGAEITGYYVNYREVIGGVPGKWKEANIKAVSDQ
AYKISNLKENMIYQFQVAAVNLAGVGTPSQPSASFKCEEWTIAVPGPPHGLKYSEVRKTS
LVLQWKHPVYSGRTPVTGFFVDMKETKAKDDQWRGINEKAIPNTYLKVQNLKEGVSYMFR
VRALNQAGVGKPSDIAGPIVAETRPGTKEIVINVDDDGVISLNFECDQMSPDSKFVWSKD
YVPVEDSPRLQVDTKGNKTKTTFKDLGIDDLGIYSCDVTDTDGIAASYLIDEEEMKRLLA
LSQEHKFPTVPLKSELAVEIMKKKVRFWMQAEKLSGNAKVNYIFNDKEIFEEPKYKMRMD
RNTGIIEMIMEKLQDEDEGTYTFQIQDGKATNKSTLVLIGDVYKNLQKEAEFQRQEWIRK
QGPHFAEYLSWEVTGECNVLLKCKKETHIVWYKDEREITVDEKHDFKDGICTLLITEFSK
KDAGFYEVILKDDRGKDKSRLKLVDEAFKDLMTEVCKTIALSATELKIQSTAEGIRLYSF
VTYYLDDLKVSWSHNGTAIKYSDRVKSGVTGEQIWLQINEPTPNDKGKYVMELFDGKTTH
ERKVDLSGQAYDEAFAEFQRLKQAAIAEKNRARVLGGLPDVVTIQEGKALNLTCNLWGDP
APEISWLKNEKPLASDDHCILKLESGKTAYFTITAVQTNDSGKYSLVVKNKYGTETSDFT
VSVFLPEEEAAKAASETPKQSKKAK
Download sequence
Identical sequences F7GDR9
ENSMODP00000026819 13616.ENSMODP00000026819 ENSMODP00000026819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]