SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026949 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026949
Domain Number 1 Region: 122-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000879
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 23-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000117
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026949   Gene: ENSMODG00000022514   Transcript: ENSMODT00000028368
Sequence length 194
Comment pep:novel chromosome:BROADO5:Un:98725764:98726816:-1 gene:ENSMODG00000022514 transcript:ENSMODT00000028368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKKNQHSHFLSILCTAPLSKPTIVTSNITAVETKEFSLTCQATGQIHAYQWFINGVAPA
GRRLQLSPDRRTLTLRRLTRRYNKGPYECKIRNPFYSNRSDPFTLDVAYGPDIATIDRIS
DQFATGINVTLRCVADSNPPAQFTWLQNGQSVSNSASFWLYASLNHIGNYTCMQTNSLLG
LKCTANKTLMIYGE
Download sequence
Identical sequences H9H828
ENSMODP00000026949 ENSMODP00000026949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]