SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027086 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027086
Domain Number 1 Region: 820-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 708-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 64-124
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 597-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 876-933
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 652-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 12 Region: 764-821
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 13 Region: 261-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 14 Region: 918-964
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 15 Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000645
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027086   Gene: ENSMODG00000005578   Transcript: ENSMODT00000028594
Sequence length 978
Comment pep:novel chromosome:BROADO5:Un:53463423:53470480:1 gene:ENSMODG00000005578 transcript:ENSMODT00000028594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASAPGLAARAPPFEDMMSWPERSGAGRGSEDTKPPGLLAAVLQVAPSCLGPDGRWVSR
APVMAEPLTFRDVSVDFTPEEWAQLDPAQRALYRDVMLENYENLLFLGLPVAKPDVVCQL
ERGEAPSFPEQPEFFAGACPGDNAFGRDFDLGSIFVPQQRVPSGQNLFKYDPLGNSFDQF
SDLILYNGMSLENKHCKYNKWKKPFDYPPDLFQFQAVNPGNKPYEYNEFGKTFNPGTPLI
YHPIMNTGEESFEYNGCGEGFSQRPYFNERKRTPAGEKLFHCTECGKSFNHKGNFTKHQR
IHTGEKPFQCNECGKAFSRRGNLTVHQKIHSGEKPFKCNECGKAFIRRGSLIEHQRIHAG
DKPFHCRQCGKTFSQRGSLTEHQRSHTGEKPFKCTECEKSFCQRTSLFYHQRVHTGEKPF
SCKECGKVFSRSGSLSKHQRIHTGEKPFECNECGKSFSQRGNLAKHQRIHGGGKPFECNE
CGKNFTNASCLAIHQRTHTEEKPFKCNDCGKAFSWRVRLIVHQRIHTGEKPFGCNECGKV
FSQRGHLNAHKRIHTGEKPFVCNECGRAFSQRICLTEHRRIHAGEKPLECTECGKNFSHR
TSLFYHQRIHTGEKPFECNECGRTFSQSGNLTEHQRIHAGEKLFECNECGKAFSNNSRLA
LHQRSHNGEKFFQCNQCGKVFGQRAHLNAHRRIHTGEKPFECSECGKAFSWRVSLTVHQK
IHTGEKPFECSECGKVFSQRGHLNTHKRIHTGEKPFECNECGKAFSQRGHLTEHQRIHAG
EKPLECNQCGKNFSHRTSLFYHQRIHTGEKLFGCNECGKVFSQSGSLTKHQRIHTGEKPF
KCDECGKSFSQRGNLTKHQRIHAGEKPFECTECGRAFSQKVHLTEHQRTHAGEKPFECNE
CGKNFSHRSSLFHHQRLHTGEKPFGCNECGKLFSRYGSLRKHQKIHIGEKPFGCDEFGKP
FNQIRPMNEQEIIHAGEK
Download sequence
Identical sequences H9H8G2
ENSMODP00000027086 ENSMODP00000027086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]