SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027204 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027204
Domain Number 1 Region: 270-400
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-29
Family APC10-like 0.0019
Further Details:      
 
Domain Number 2 Region: 1848-1909
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000294
Family ZZ domain 0.0077
Further Details:      
 
Domain Number 3 Region: 1806-1857
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000895
Family ZZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027204
Domain Number - Region: 1124-1216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000994
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number - Region: 2730-2819
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0484
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027204   Gene: ENSMODG00000020584   Transcript: ENSMODT00000028734
Sequence length 2982
Comment pep:novel chromosome:BROADO5:Un:38499927:38558738:1 gene:ENSMODG00000020584 transcript:ENSMODT00000028734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVPSAYSDDDELEGPGEAGAAPGAGPVAAGADAPGLHRSPGPEGSPSAAAAGGLPRAP
ALLEPGALREAAARLSPGATPSPSPASTSGASGRPQAALLRWLEERRIRGDIVVSVEQLR
EALEARGAGDEAEERPQVVGQFEAEGDGTVDVETALEALKSARGASLPGELSHVTRQLQA
CPLVPGFVDIFAEAREGLGAHCSLILRFLHRHRVASAAIPYPLLDYCHTISALRSLVLKE
ALERLARRDKEGPGELGGGQEAEQLKSVAKCYAYIETSSNSIDIDKMTNGDTASFWQSDG
SARSHWVRLKMKPDVVLRHLSIAVAASDQSYMPQQVTVAVGRSANSLQEVRDVHIPSNVT
GYVTLLENANISQLYVQINVKRCLSDGCDTRIRGLRAVGFQRVRRGGVSVSDASAIWYWS
LLTSLVTASMETSPAFVQTVLQNTQKALQHMPPLSLSPASTEGASFLSPSVLGEVDSFLV
RITSCSAKPEVELTLLAFALARGSIAKVLSSLCAITDRLDTPYQASGLLSSMAAVRQNLL
YKYGRILQPTLQACDVKGKGEKSGPENLLAEPWTGDGFLTETGKTRASVIFSTGTEAAFQ
VTQLRIKVRRGGIGAQCGLLFAYNSASEKFHAEEHFKRFEKYDTWKLPEFRQFLKSRMGN
SSTDLGEDEPAGWFEAEEDWDEVEVKMNCCRVAKYLMVKFLCTRRETAERLGVQGLSVYG
YVRPAAAELGTGTACARCEPEADRICGMTLLLRTLSFIQQLAQDLARQKESGLKHKPLLD
TAGLHLQLFWSFYSRLESRPREECVLARTLLLQLLQSCLADLTADPPPPAGQGCPPGERP
ESRRRAQAAPEELYAHLCQVVDQDAADSLPARRLQEEVRNTLLQGAAVFFPDGHARRRHL
FAMMKNVTEQEQKPSAHLTFRSLCAYFSGCDPGGLLLLPDKGGSEGLDVQEALAVMDTLQ
AAAARECDALMLGTAQGESSPALFSLFWSVQGSLLSWCYLQFKGNEPHAKRLAAEVVERY
VGQFLASVRRALRSLLSRYSGKEVVERLCNSVFAMATRQLVIFLLDFCTLDLPHLTLLKE
FSTLTEPLKSLCGDPDGGGPDRLDMETWQREQPVVLNTWSMESAHNYENNCHEVAVFVSP
GATSFEVVFDDKCETETRYDYLEFTDARGVKTRYDTKVGTDKWPKKVTFRAGPRLHFLFH
SDSSNNEWGYKFTVTAYGLPDVAISWGLDLQLLVSRLMGRLASQCLSLKPDHLGSDGGLP
PAKVAAVLHSPLWKSVFRHQLCPQEVPGACGPSLPAPGGKESPSARADACRDVLLDFATA
APAPASGGRSSELVQGLAQACRRQAPQTDRVAGSAVDGAVNATFAALVYLTPPLYEKLQS
YVSSGGQLALSEDFAQVYALADGIRIWMLEMKQKFLLDQGDEVEGEPGAEMREVNPENLA
KQCVQKSLLLLRFVPKGAGPRGGPRDRLARQDEAAPLQPQGAGQKAACVVEEYFQASEGS
PAPGPESPSPGGPPKKGHDSPFQQAEPSPAACGNLLPEDVASPPSTPTRKPGFSRGRLRL
LSFRSMEEARPVATVTEKYPCLKDVMDFIKDQTLSHESVLKVLSLKKAQAQGILDVLKTS
QQCLEPLGQPHCFHAACLLFLLELLSCQKDLADYLEHLEGCGAELHTEIRRSYHQLVRFL
VDAVKGFGKLDDSFPRGLSPPLSEVRGGLCSLLLGNGGEPSDLPFLVDIQLPELLMTMSQ
ENISLHDSVICQWSEEDEIADYKQTSEWMDECQDGMFEAWYEKISQMDPEKQRKMHMFIA
RYCDLLNVDISCDGCDEIAPWHRYRCLQCHDMDLCKTCFLGGVKPEGHEDDHEMVNMEYA
CDHCQGVIVGRRVNCNVCDDFDLCYGCYSAKKFSDSHLPSHGITVYPMVTIRTSDHQRLI
QPYIHNYSWLLFAALTLYTADLAGGGEGEGQRLGAEDHQAAATLRDQCLELIGDCLVKAQ
RAKDRGPQSPHLLCMLPDGELPSENETVPKSSSRDGATEMKDKASAVSSTVVPTSGDGAS
PLNKEVSPVNFLNNSTSLLGVLIFIDTLCQEKSLPSPHSPPPPPSPPGPQPYGGASSLET
VEENVTALSPEQVFAECSQKRILGLLAAMLPPLQSGSTISWANLDHILPLMFQVVISNAG
HLNETYHLTLGLLGQLVVRLQPAKVDAAVSEALSAKHTLLSAGDGSASPEGWKTVHLLFS
LGAVCLDSRVGLDWACSMADILRALHACPQWHSVVAAFTDHCMKQLPFQLKHTNIFTLLV
LVGFPEVLCMGARSVYLDNANEPHDVIVLKHFTEKSRVVVVDVKTRKRKTVKDCQLVRPS
GPGSAAERAPLHAQLPYFTFISSRLLQDGLDQGYPEAVEATWVLALALKGLYRTLMAHSF
EEIQAAFLESGLLKLLVKKCSRGTGFSKTWLLRDLEILSVLLYSSKREMSGGTEQEAGAG
PPQPGSPPGDVGQSKPDPLEGLDEATKVCFLMTHDALNAPLPILRAMYELQMKRTDSFFL
EVQRRFDGDVIATDDRIRALAQKWQPRKRPRLEELSARAVDTDMIVLPCWSRPAACDQAA
EESDPVTQKLIAGTESDLRLSYAKQRRAKSAGLLHKELGARAKGAATRAYLHRVNEATAV
LYARHVLASLLAQWPEPVPITVDVLELASPAQMAYILDTLMQLEERQLWEKILEKALLGC
SHDMLGPVALTACQFMEEPGTAVQVCESKHPYSNNTTFEDKVHIPGAIYLSVKFDPQCST
EEGCDELAVASSSDFQQDRHSFSGSKQKWTDFELPGDTLYYRFTSDMSNTEWGYKFTVTA
GHLGRFQTGFEILKKMLSEERVVPHLPLARIWEWQVGVACRQTGHQRLKAIHLLLKIVQC
STPSDLCDLTLLKPLWKLFAQMEKGLCQDVGQSSVLLPLHRALTELFFVTENRVQELGSL
QDYLLALTTDDYLLCCTAQALRNIAAISLAINYPNKSTSVWT
Download sequence
Identical sequences H9H8S4
ENSMODP00000027204 ENSMODP00000027204 13616.ENSMODP00000027204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]