SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027423
Domain Number 1 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 634-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 411-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 676-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 10 Region: 162-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 45-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 12 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-16
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027423   Gene: ENSMODG00000022826   Transcript: ENSMODT00000028964
Sequence length 741
Comment pep:novel chromosome:BROADO5:Un:10741616:10775420:-1 gene:ENSMODG00000022826 transcript:ENSMODT00000028964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSGKELLSLPRKTQRRERRAAKVRTGSPESQGMALESDRPQAQEAVTFQDVAVDFTR
GEWRLLSPPQKELYKEVMLENARNLLSVGLAVPRDVISYVEQREAPWRLEQEGLRSCSPE
IRPEMKVTPKDASLSVEDSDRQRFMSDGPNKLSWRELFFESQNSFLIDHQRMHTEQKSRE
CNQCGKIFMHRASLAGHQRIHTGEKPYACRQCGKTFRLSSSLAAHQRIHTGEKPYECKQC
GKTFSQSSHLAVHQVIHTGEKPYECKQCGKTFRLSSSLVVHQRIHSGEKPYECKQCGKTF
SQSSHLAGHRGIHTREKPECKRCGKTFRHSYSFALHQRIHHGEKPYECKLCGKTFSGIIS
LAIHQKTHSVEKVYHCKQCGKTFSQSSSLAEHQRIHSGEKPYECMQCGKKFRYSYSIAVH
QRIHTGEKPYKCKQCGKTFSGILSLTVHQRIHTGEKPYECKQCGKTFSRSCSLALHQRTH
TREKSYECKHCGKTFRLSSHLVVHERMHTGEKPYECKQCGKTFSRSSHLVRHQRIHTGEK
PYECKQCGKTFCRSTTLAEHQRTHTGEKPYKCKECGKTFSRNFSLAEHQNIHTGKKPYEC
NQCGKTFNQRAHLAVHKRIHTGKKPYECKQCGKTFKLRSELAVHQRIHTGERPYECKQCG
KTFRNSSSLSVHKRIHTGEKPYECKQCGKTFINSSSLARHWRIHTGEDRCECKQCGKTFS
RSSSLAAHQRIHTGEKLNVYN
Download sequence
Identical sequences H9H9E3
ENSMODP00000027423 ENSMODP00000027423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]