SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028593 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028593
Domain Number 1 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 646-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 702-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 69-127
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 593-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 10 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 11 Region: 746-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 12 Region: 494-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000172
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028593   Gene: ENSMODG00000023142   Transcript: ENSMODT00000030176
Sequence length 805
Comment pep:novel chromosome:BROADO5:2:522163627:522188295:1 gene:ENSMODG00000023142 transcript:ENSMODT00000030176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLQGQAPAGHVTLTHQESGFPQVSSLEEEEGGTSGVLAARFRSYVTLESLHLYSNLAD
TIAPGRIEIKESLTFKDVAVEFTWEEWRHLDPTQRALYRDVMLENYENLVSIGIPVSRPD
LTFLLKRKDIWNQEEEVRTGISPGELKSAFIAPWRRALEKSLHIYKGLGRSFRDLPDTCD
TFFLGKNLYQYTTFKKPFSYHSDLIKLKGMLAREKLHESRKLNGRRSNFTVYQKIQKGEK
HYICNECGKAFSRKGHLVSHQRTHTGEKPFRCNECGKAFSWKESLIIHQIIHTGVKPFKC
NECGKAFSQKRKLINHQRIHTGEKPFKCNECGKAFSWKESLITHQSTHTGEKPFECNECG
KTFSARKSLIKHQSIHTGEKPFQCNECGKAFSQKVNLITHQSIHTGEKPFECNECGKTFS
RKGHLVSHQRTHTGEKPFECNECGKAFTWKESLIIHQIIHTGEKPFKCNECGKTFTQKRK
LITHQRTHTGEKSFECNECGKDFSWKESLIAHQSTHTGEKPFECNECGKAFSVRQSLIKH
QRIHTGEKPFQCNECGKAFSQKVNLITHQSTHSGEKPFECNECGKAFNQILLRKGHLVSH
QRTHTGEKPFRCNECGKAFSWKESLIIHQIIHTGVKPFKCNECGKAFSQKRKLINHQRIH
TGEKPFKCNECGKAFSWKESLITHQSTHTGEKPFECNECGKTFSARKSLIKHQSIHTGEK
PFQCNECGKAFSWKGSLIIHQRTHTGEKPFQCNECGKAFSHKRRFIIHQRIHTGEKLFEC
NECGKDFSCKESLITHQRTHTGEKP
Download sequence
Identical sequences F7CQB3
ENSMODP00000028593 ENSMODP00000028593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]