SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030198 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030198
Domain Number 1 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 817-874
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.48e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 650-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 761-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 873-930
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 708-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 92-152
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 388-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 12 Region: 915-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 13 Region: 327-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000197
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030198
Domain Number - Region: 257-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000268
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030198   Gene: ENSMODG00000023513   Transcript: ENSMODT00000031769
Sequence length 977
Comment pep:novel chromosome:BROADO5:4:404499875:404525846:1 gene:ENSMODG00000023513 transcript:ENSMODT00000031769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTECPEDVPGGGRQPQAGREEARVSGSERRLKEKESFFCLLEAVVPVGVPASLLPRKKR
QRALPLVDPCPSMPSSACRGARGMAPGSPSPPAQKLVTFQDVAVDFTQEEWHLLDHSQKE
LYMAVMLENAQNFFFLGLLFPRESNISCFQPGEAPWMQESEGPRNSCPEIKFKVKEMGTK
LSIFAEESHHEKSIGHASCDFSLREKCDSDIKAERYPKSYYEFDEDGKSVRQYSFLIQCK
KMTPGKDCSQHGKYRESSNEQVEQLIKSHEKPPQVEAYQCTHYEMVFRPSSELIQHQKSH
SGRMLCIHNENRKMTPKPKLVDLQILHTKKEASECNECGTTYSDPSSLTDQLQFHSAKKP
SACNQSRNPFDWKSDLLKHPEVCTSNDPYKCNECGMTFSYMSHLMDHQRTHNGEKLYECN
QCGKAFKISSSLKKHQRIHTGEKPFECYQCGKTLRSILSLRYHEKIHTGEKPYECQQCGK
TFRSSSNLSVHQRIHIGEKLYQCDQCGKAFRISSSLKKHQRIHTGEKPYECNQCGKAFTR
KTSLTYHERSHTGEKPYECNQCGKTFRSSSNLSDHQRIHIREKPYDCHQCGKAFRSRFSL
RKHQRIHTEEKPFECNQCGKALRSILSLRYHEKIHTGEKPYECHQCGKGFTQKNDLAVHQ
RIHTGEKPYECHQCGKTFRSNSDLARHQRIHTGRKLYECNQCGKTLTSRSSLINHQRIHT
GEEPYECHQCGKAFKSSCSLKYHEKMHTGEKPYKCNQCGKAFRISSILRNHQGIHTGEKP
YGCNQCGKAFRSRYLLSHHQRIHTGENPYECNQCGKAFRSIPSLRYHEKIHTGEKPYECN
QCGKAFRSSTSLKYHEKIHTGEKPYECNQCGKAFTESRHLIQHQRIHTGENPYECNQCGK
AFKSIPSLRCHEKIHTGEKPYECNQSGKTFTWKHVFAVHQRIHTGEKPYECHLCGKTFRS
RSSLNSTSENSHRRETL
Download sequence
Identical sequences F7DDX2
ENSMODP00000030198 ENSMODP00000030198 XP_007492488.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]