SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030496 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030496
Domain Number 1 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 728-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 671-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 620-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 58-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 11 Region: 248-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000169
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030496   Gene: ENSMODG00000023578   Transcript: ENSMODT00000032067
Sequence length 800
Comment pep:novel chromosome:BROADO5:3:504372176:504402709:-1 gene:ENSMODG00000023578 transcript:ENSMODT00000032067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSQKLFRKIFLPDQLLTLVMRRSFRSPSLFLLHRISYFTQRAHPISMIPQREKYLRAS
IAFKDVAVDFTQEEWCLLDHSQKELYLEVLLENVQNLLSVGLPVPREKFISCFQQGNVSW
LLDRKGPRSCCAEWQVRESEEICAPNIKVNKNPKSDNEFDETVEKFSQYSALNQYMKLTL
GNDCCQDSEYRKSFPEEVELVQSPKELEMPTYQGNLGGMAFGWSLNLIRHPKIKHVEIVS
VSDKGGRPLNHNSELAAHQRIHTREKPYECKHCGKAFKRRGHLAAHQTVHTGEKPYECKH
CGKAFTMKSNLAKHQRIHSGEKPYECKHCGKAFTRRGNLDIHQRIHTGEKPYECEHCGKA
FTVRSNLAKHQRIHTGEKPYECKQCGKGFTQSDSLAAHQRIHTGEKPYECKQCAKAFTQR
AHLVAHQRFHTRDKPYECKQCGKAFTGSGQLAAHQRIHTREKPYECNQCGKAFTQRGHLA
RHQTIHTGEKPYECTQCAKTFTERGNLFAHQTIHTGEKPYECNQCGKAFTERSSLAAHQR
IHTGEKPYECKQCGKAFTERGHLARHQTVHTGEKPYECKQCAKAFTERGSLATHQRIHTG
EKPYECNQCGKAFTWKESRGSLAKHQRIHTGEKPYECKQCGKAFIRRDYLAAHQTVHTGE
KPFECKQCGKAFTLKVSLAKHQGIHTGEKPYECKQCGKAFTERGNLATHQRIHTGEKPYE
CKQCGKAFIGRGHLVTHQRIHTGEKPYECKQCGKAFTQRGSLAAHQRIHTGEKPYECKYC
GKAFTERGSLGKHQRNHTGE
Download sequence
Identical sequences F7G1B0
ENSMODP00000030496 ENSMODP00000030496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]