SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031113 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031113
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-28
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 200-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000224
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031113   Gene: ENSMODG00000004159   Transcript: ENSMODT00000032682
Sequence length 488
Comment pep:novel chromosome:BROADO5:2:257748746:257762525:1 gene:ENSMODG00000004159 transcript:ENSMODT00000032682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADCVSQEPQLLRESAPLSPKVPASLNEGNLGDQMLAISLLKAKSQELVTFEDVAVY
FIRKEWKRLDPAQRDLYRDVMLENYGNVFSLGFPFPNPEIISHMDGEEESWVLDLKAAES
QELQSGSCIDGETRTQNDQDISEAAESHGVMLGRFQKDVPSSLKFGEACEWEGNLERQLG
NSMEERLRRKMGDFRQVIVEDQKIPTGERVQQYKEFGNSFSLNSNLVIHQRGSVGDKPHK
CDECGKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECNDC
GKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHHQRIHTGEKPYECNECGKAF
SRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECRECGGRFTYSS
GLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKSLNVMTMGKGSIRVAALNI
RESIHMRE
Download sequence
Identical sequences F6TZF0
XP_016286357.1.35504 ENSMODP00000031113 ENSMODP00000031113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]