SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031119 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031119
Domain Number 1 Region: 51-141
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-39
Family SCAN domain 0.0000555
Further Details:      
 
Domain Number 2 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.67e-28
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 220-277
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000235
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 6 Region: 352-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000314
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031119   Gene: ENSMODG00000004145   Transcript: ENSMODT00000032688
Sequence length 560
Comment pep:novel chromosome:BROADO5:2:257841788:257856937:-1 gene:ENSMODG00000004145 transcript:ENSMODT00000032688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAESRDAAVMTPQAIQDKEGLVIVKVEEEDEDEHLWGQDTSIQRNNSPSDPEIFRQRF
RQFCYQDTSGPREALGRLRELCHQWLRPEMNTKEQILELLVLEQFLAVLPREIQTWLQEY
RPDCGEEAVTLLEDLELDLSGQQVPVRVHGHEMLAREMVPLGAVHESSSFEFQHRTPQIK
HVTRKPSLLQQSAYSASHVPVSHERSPRDQAVASALFTADSQALVKIEDMAVSLILEEWG
CQNLARRNLCRDNRQENYGTMFSQGCGSRTTNEESTSKEDVAEATGSHGEIPGRFQREFG
ETCEQESRLERQQRNLEEKLRLEKTEFRQVTVKDKKAPTAERGQREKGKGLGRSFSLSSN
LVTQEEVPTGTKSHKCDECGKCFTRSSSLIRHRIIHTGEKPYECNECGKAFSLNSNLILH
QRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIH
TGEKPYECNECGKAFNRNSYLILHRRIHTREKPYKCNKCGKAFTRSSTLTLHHRIHNRER
ASDYSSPSLDAFGAFLKSCV
Download sequence
Identical sequences F6TZA3
ENSMODP00000031119 XP_016286356.1.35504 ENSMODP00000031119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]