SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031673 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031673
Domain Number 1 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 752-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 696-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 531-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.59e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 111-170
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 472-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 854-906
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.77e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 10 Region: 808-865
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000518
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 381-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000118
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031673   Gene: ENSMODG00000006659   Transcript: ENSMODT00000033246
Sequence length 912
Comment pep:novel chromosome:BROADO5:3:447908628:447923502:1 gene:ENSMODG00000006659 transcript:ENSMODT00000033246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKKIERSWMREPPGSQDSLQEKACCSPDPLFRKIEPQEGENPEATGAEVVSIQGDQNFI
VAKKLEEYQRRMTMADKTHILQKRAPWSLKPSLPQKWITEEEAVASRSVLSWEAVTFKEV
TVDFTREEWEHLDPLQRDLYRDVMLENYRNLVSLGLMDSKPVMISWLEDWEELQQGNEKE
IILTGINPDWESKYQTQKSSPKQDFTEEVDHPERLVELLTREVVHTGCMFGKAPKQGSRF
LSQRENLADETPKNYDSQEIDFLQVIVSNKKNFAIHKNHNEFDKTFNQGSCKQIKNWNCS
ECENIFSYHPTLTQTQTLNGKEKPCQYEECGRAFNINVELGEHNQIHTGQKPYEYNDYEK
DSSHSSFHIKSRGINIGEKSCEHRKYGKAFNQRADFVYQGIHTGEKPHECHKCWYSFSQR
SSLIHHQKINSRGNPYKCNECGKVFSTGGSLIEHHQMHSGEKPYKCSECGKAFSYKPYLI
QHQKIHTGEKPHKCNECGKTFRTRTQLNRHERFHTGEKPYECRECGKALSDSSSLIEHQR
IHTGEKPYKCTDCGKSFSKRARLTPHQRIHTGEKPYECNECEKAFRDSSSLINHQRIHTG
EKPYECKECRKAFSRKTNLTVHERIHTGERPYECHECGKTFSQRSSLIHHQVIHHGENGY
KCNECGKAFSIEAHLIEHCRMHTGEKPYECHECGKTFSRSSSLTQHQRIHTGQKPYKCTE
CGKAFCRRTHLTQHQRIHTGEKPYECSKCEKSFSDRSSLSQHQRIHTGEKPYECKECGKA
FSQRTQLKKHQRIHTGEKPYECHECRKTFIQKSGLSYHQRMQSEGNNYICNECGKAFSRN
SCLIYHQFIHDRNKLYECKVCGKIFSQNSSLMEHQFIHMGKKSFVCNECGKSFFLSKSLK
RHERIHMGKEIS
Download sequence
Identical sequences F6VS65
ENSMODP00000031673 XP_007489213.1.35504 XP_007489214.1.35504 XP_007489215.1.35504 ENSMODP00000031673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]