SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032001 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032001
Domain Number 1 Region: 1829-1897,1940-2008
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000297
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 423-489,532-600
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000041
Family I set domains 0.07
Further Details:      
 
Domain Number 3 Region: 1657-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000106
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 2455-2569
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000241
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 1306-1385
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000377
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 949-1030
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000129
Family I set domains 0.0096
Further Details:      
 
Domain Number 7 Region: 1128-1209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000235
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 2008-2090
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000238
Family I set domains 0.071
Further Details:      
 
Domain Number 9 Region: 599-679
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000239
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 774-850
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000562
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 342-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000878
Family I set domains 0.01
Further Details:      
 
Domain Number 12 Region: 2186-2266
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000108
Family I set domains 0.024
Further Details:      
 
Domain Number 13 Region: 1474-1555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000326
Family I set domains 0.021
Further Details:      
 
Domain Number 14 Region: 1717-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000373
Family I set domains 0.01
Further Details:      
 
Domain Number 15 Region: 2338-2440
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000428
Family I set domains 0.025
Further Details:      
 
Domain Number 16 Region: 2281-2362
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000117
Family I set domains 0.043
Further Details:      
 
Domain Number 17 Region: 2100-2188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000128
Family I set domains 0.011
Further Details:      
 
Domain Number 18 Region: 1396-1484
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000117
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 1541-1648
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000406
Family I set domains 0.017
Further Details:      
 
Domain Number 20 Region: 1221-1308
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000101
Family I set domains 0.0091
Further Details:      
 
Domain Number 21 Region: 868-956
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000131
Family I set domains 0.017
Further Details:      
 
Domain Number 22 Region: 692-780
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000134
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 1045-1132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000841
Family I set domains 0.02
Further Details:      
 
Domain Number 24 Region: 225-316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000997
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032001   Gene: ENSMODG00000028921   Transcript: ENSMODT00000033575
Sequence length 2590
Comment pep:novel chromosome:BROADO5:Un:2934818:3486826:1 gene:ENSMODG00000028921 transcript:ENSMODT00000033575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQGLLAAQTQKQNINRQQNPCPSRSGSQSRSWSCSHSASPSPSPPRTGNRTAHCSNHHS
SSYAQPHTHSHHLHNTNHHPSNTCPTRRKATGLAKRKAKKGRSPYGREKRADRRAPVLKR
KIPVLWSRGSSLHRDRDRLWGSHTVVSLESSRDSSRETPKDETPCWVGEQRFLGRREAVT
PDEQCRPMERPSKASQSRGSTWKGLLIITATILSCWIQPTSAQDITVEVEPPLGTQGLSV
TFRIVGYSGTPVMYNWYYKTSAQQPSRKHIVTYSTYNRRQLQTKIRQRVYHNGTMFFPNL
LVNDSGYYEVQIIKDRWTLDRPEAGAPLTVYVGLSKPNIVTSNNTAVENNDFTLTCNATG
YLPSTTWYINQRVQHGTGRIRLSPDNKTLTLPKITRSENKGPYMCEMVNIVSHVYSDGFI
LDVAYGPDSMTILPAADRYNVGEHIQLTCSAQSCNPPAQLTWLQNGQPVSNSGTFSATAA
LNHAGNYTCVAYNSLTGIRHSQSMNIIIYGPLSKPIILTSNNTAVETKDFSMTCQPSGAI
VTTRWFINGLPAGGNRIQLSPDKSILTIRNLRRTENKGPYECETENTVSVNKSDPFTLDV
TYGPDNATIAHLSNVYPTGANIIFNCSADSNPPAQLIWLRNGQQIRNSPIFSIIASVGDA
GTYTCTASNSLTGLTRTASKTLRIYAPLSKPTILISNKTAVETKDFSMTCQATGQIEAYQ
WFINGLAPVGSRIQLSRDNRILTLPRLTRRDNQGPYVCGIENALFSSMSDPFILDVTYGP
DTATIVRTPDVYPTGANIIFNCSADSNPPAQLIWLRNGQQIRNSSIFSIIASVGDAGTYT
CSASNSLTGLTRTSNKTIRIYAPLSKPTILISNKTAVETKDFSMTCQATGQIEAYQWFIN
GLAPVGSRIQLSRDNRILTLPRLTRRDNQGPYVCGIENALFSSMSDPFILDVTYGPDIAT
IVHTPDVYPTGANIIFNCSADSNPPAQFIWLQNGQRVSSSATFSIIASLSDAGTYTCTAS
NSLTGLTRTATKNITIYAPLSKPTIITSNNTAVETKDFSMTCNATGQIHAYRWFINGLAP
VGSRIQLSPDKRILTLRRLTRRENKGPYVCEIENPLFRNRSDPFPLNVTYGPDIATIVRS
PDVYPTGVNITLSCVADSNPPAQFTWLQNGQSVSNSAIFSVISSLNHAGTYTCTASNSFT
GMTRTATKNIIIYAPLSKPTIITSNNTAVETKDFSMTCNATGQIHAYRWFINGLALGGNR
IQLSPDKRTLTIRSLRRTENKEPYVCEIENPLFSKRSNPFTLNVTYGPDNATIVHSANEY
PTGANITLSCVADSNPAAQFTWLHNGQPVSNSATFSVIASLNHAGTYTCTASNSFTGLTR
TATKNIIIYAPLSKPTIVTSNITAVETKDFSLTCQATGQIHAYQWFINRVAPAGSRIQLS
PDKRTLTLSRLTRRDNKGPYECEILNPFYSNRSHPFTLDVAYGPDIATIDHISDQFATGI
NVTLSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCIATNSFTGLTRTANK
TLMIYAPLSKPTILTSNNTEVETKDFSLTCYATGQIHAYKWFINGVAPAGRRIQLSPDRR
TLTLRSLTRSDNKGPYVCEIENPFYHNRSDPFTLDVAYGPDIATIVHTPDVYPTGANITL
SCSATSNPPVQFTWLHNGQPVSNSATFSFIASLNHAGTYTCTASNSFTGLTRNATKNLII
YAPLSKPTIVTSNITAVETKDFSMTCQATGQIHTYRWFINGVAPAGSRIQLSPDKKILTI
PNLTRRDNKGPYVCEIENPLFSNRSDPFTLDVAYGPDIAMIVRTQDVYPTGANITLSCSA
ISNPPVQFTWLQNGQPVSNSATFSFIASLNHAGTYTCIASNSFTGLACTANKTLIIYAPL
SKPTILTSNRTAVETKDFSLTCQGTGQIHAYRWFINGLAPSGSRIQLSPDKKILTIGNLT
RRENKGPYVCEIENPLFRNRSDPFTLNVTYGPDIATIAHSVDEYPIGANITLSCSAVSNP
PVQFTWLHNGQPVSNSATFSFIASMTLSGTYTCNAANSLTGLTRSATKNVIIYAPLSKPT
IVTSNITAVETKDFSFTCQATGQIHTYRWFINGLAPSGSRIQLSPDKRTLTIRNLIRTEN
KGPYECEIQNPFYSNRSDPFTLDVAYGPDTATIVRTVDEYPIGANITLSCSSKSNPPVQF
TWLHNGQPVSNSATFSFTASLSLAGTYTCSAANSFTGLTRTATKNVIIYAPTSKPTIITS
NIAPVENKDFSMTCQATGQNHTYRWFINQSAPSGSRLQLSPDKRTFTIRSVTRRENKGPY
VCEIKNPFYSNRSDPLTLNVTYGPDTPVIVPTIDAYPIGANITLLCSAVSNPPAQFNWLY
NGQQVSNSATFSTITFLSQSGTYTCHASNSFTGLQATKDMNITIYGPLSRPIINSPNRIP
VENIDTVSLTCNATGQVRTYQWFINNRAPTDNRIQLTRDKRTLTVGSLTREHEGSYVCEI
KNPFYSNRSDPFTLNVYYGPDNAIILPKVDRYLVGTNITLSCSAKSKPPAKFIWFHKGKK
WRPSNETLSY
Download sequence
Identical sequences M9MMJ0
ENSMODP00000032001 ENSMODP00000032001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]