SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032525 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032525
Domain Number 1 Region: 89-294
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-52
Family DBL homology domain (DH-domain) 0.0000000131
Further Details:      
 
Domain Number 2 Region: 299-461
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-33
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 585-686,731-757
Classification Level Classification E-value
Superfamily SH2 domain 1.49e-25
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 4 Region: 510-593
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000906
Family SH3-domain 0.0000331
Further Details:      
 
Domain Number 5 Region: 694-745
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000025
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032525   Gene: ENSMODG00000002314   Transcript: ENSMODT00000034109
Sequence length 765
Comment pep:novel chromosome:BROADO5:3:445000102:445031043:1 gene:ENSMODG00000002314 transcript:ENSMODT00000034109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLMLGGGYMAGPILVPISKSIFHVQVIYTLSALSWTTIAQDKGIVPFPTDEDSLGDDDI
YSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRTEPTPMLPKMTELDKRACCLRE
IQQTEEKYTDTLSSIQQHFLKPLQRFLRGEDIEIIFINLEDLLSVHSCFLRDLKDALSAN
GAPDLYQVFISYKERFLVYGRYCSQVESASKHLDRVASMREDVQMKLEECSQRANNGRFT
LRDLLMVPMQRVLKYHLLLQELVKHTTDTTEKENMRLALDAMRDLAQCVNEVKRDNETLK
QITNFQLSIENLTKNLAPYGRPKIDGELKIATSERRSKIDRYAFLLDKALLICKRRGDVY
DLKDFVNLPSYQVRDDSSGERDNKKWTHMFLLIEDQGTQGYELFFKTRELKKKWMEQFEM
ALSNVYPENATANGHDFQMFSFEETASCKACQMLLRGTFYQGYRCHRCRAPAHKECLGRV
PPCGRHNSDFPSTMRKHKPSRLAQDKRKNELGLPKMEVCQEYYGLPPPPGAFGPFLRLNP
GDIVELTKAEAEQNWWQGRNTATNEMGWFPCQKVKPYVHGPPQDLSAYLWYAGPMERAGA
EGILANRSDGTFLVRQRVKDSAEFAISIKFNVEVKHIKIMTSEGLYRITEKKAFRGLVEL
VEFYQQNSLKDCFKSLDTMLQFPFKEPEKRAIAKPPATGSTRYFGSAKARYDFCARDRTE
LSLKEGDIIKIISKKGNQGWWRGEIYGRIGWFPSNYVEEDYSEYC
Download sequence
Identical sequences F7A3L2
ENSMODP00000032525 ENSMODP00000032525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]