SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000033418 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000033418
Domain Number 1 Region: 655-712
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 823-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 144-205
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 767-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 879-936
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 9 Region: 711-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 11 Region: 921-973
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 12 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000182
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 13 Region: 450-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000107
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 14 Region: 312-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000398
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000033418   Gene: ENSMODG00000004306   Transcript: ENSMODT00000034994
Sequence length 980
Comment pep:novel chromosome:BROADO5:3:432002681:432020350:1 gene:ENSMODG00000004306 transcript:ENSMODT00000034994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPRILERTWVLPRPGLGAGGPGGTSGPGGLAPRGKAVRGLRVGSDFASVVGDPGAEG
CAQGKDELSKEIEMAAPGTGPELSSVPTPQVNNSSRTPPGPPCHEVLLPLHDPHQGLLDP
SDPVQIPEWSLGDQAIAAESLPARLQTSLMFKDVAVYLTREEWDCLGPAQRSLYRDVMLE
NYRNLVSLGFSVSKPDVISHLEKGEEPWVLDKQGAREREILKSDFSDCETKTKKTELSSI
QKISEKMELQGIMLGRFKGPEFGEPCKIENQTEKHWEKPVVGVLRKSLSLERNYKPVTVI
SMKTSTRVKGQECNEFGRRLNLTSKCVKHQRVPRSEKIHPCATCGQTFKKNSDLINHQSI
HTREKAHKLNIYGEMPRQSSISIEHQRLHNTEKLYECNECGKAFSQNRTLIQHERIHTRE
KPYECGECGKTFNRSSILTKHQRIHTGERPYKCNECGKAFSARSYFFQHRKIHTGEKPYE
CNDCGKSFSTRSSFTQHGKIHTGEKPHECHQCGKAFSHSSNLIHHQRIHTGEKPYKCKEC
QKAFSRHSHLIQHQRIHTGEKPYECNDCGKAFSARLSLIQHQRIHTGEKPYECNECGKTF
SLNRTLIVHQRIHTGEKPYECNECGKSFSQRSQVIQHKRIHTGEKPYICNECGKSFSARL
SLIQHQRIHTGEKPYECNECGKTFSQKGHLIQHQRIHTGEKPYECNECGKAFSQSFNLIH
HQRTHNGEKPYECNECDKAFSVLSSLVQHQRVHNGEKPYECNKCGKAFSQGSHLIQHQRS
HTGEKPYECNECGKTFGQISTLIKHERTHNGEKPYECNECGKAFSQSAHLIRHRRIHTGE
NPYECNVCGKAFNVRSSLIQHQRIHTGEKPYECNECGKAFSQHSQFIQHQRIHTGEKPYV
CDECDKSFSARLSLIQHKRIHTGEKPYECSECGKSFRQSSHLIRHQRIHSGERPFICDEC
GKTFSQRITLISHEKIHTRE
Download sequence
Identical sequences F6XXV4
XP_007488673.1.35504 ENSMODP00000033418 ENSMODP00000033418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]