SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034644 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034644
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.25e-38
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 333-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 216-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000379
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034644   Gene: ENSMODG00000024568   Transcript: ENSMODT00000036232
Sequence length 479
Comment pep:novel chromosome:BROADO5:6:147546200:147554876:-1 gene:ENSMODG00000024568 transcript:ENSMODT00000036232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTPGNQIQASVEPEGLLIVKVEEDSFWDKETPRPKEDTDSEIFRQCFRQFHYRETDGP
HEAFSQLWELCCRWLRPETRTKEQILELLVLEQFLTVLPGGIQGWVRERCPASGEEAVAM
VEDLQKQPRNSLQQEEPSEETETQGGGRGSSGLLLAQGETHAKGVSQEEGAWSRSPGTGS
QEQRSHDSQHASQLPALLKEGSTREMVDAFFSSGIHGPMTIGDVPFYLSREEWGCLDPAQ
RELFCHIKRENFCNVSLGLEMKSQNERAFSQASLKEIDPLPGRSGGEVPWSTEEGEVWES
ENIPERELGQEHSGGVRRGRPPTRRRQFRDLATEKPHSCQQCGKRFRWGSDLSRHQRTHT
GEKPHKCQECEKSFRSSSDLVRHQGVHTGEKPFTCTECGKSFSRSAYLTDHQRIHTGEKP
YECTECGKSFSLRSYLLDHRRVHTGERPFGCSECDKSFKQRAHLIAHQSLHAKMAQSVG
Download sequence
Identical sequences F7BTR1
ENSMODP00000034644 ENSMODP00000034644 XP_001370961.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]