SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034699 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034699
Domain Number 1 Region: 46-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-33
Family SCAN domain 0.0000753
Further Details:      
 
Domain Number 2 Region: 250-310
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 468-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 509-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034699   Gene: ENSMODG00000027730   Transcript: ENSMODT00000036288
Sequence length 583
Comment pep:novel chromosome:BROADO5:6:147181124:147190000:-1 gene:ENSMODG00000027730 transcript:ENSMODT00000036288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAVELMVAADLNPQIQALWEKEGPLEENSRENSIQNQEFVLQSDELAPETWRKRFRSFQ
YQISAGPQETLNQLRELCHQWLQPEIHTKEQILELLLLEQFMNILPEETKTRVQEHSPRS
IREAMTLVDLPCTLIRQRKKDRKKIPDLDNKVTVHEQGQQVLSKAAPLEGSSEALSFHLE
PAEPQPMGVFQEEELWSTHSRLQEPLSCDPENELQPVQKRALPAHQVLVLPEERAIREWE
VTSVLFTPESQSPVTFEDVAMYFSQEEWEILGPIQKDLYKDVMQETYGNMISVALFMIPK
PELISCLEQEKEPCVTNSKESKEIPKDSNTEMTDSSICPNGINATIENEKPEEVYHIPLE
IQASDDTLSEKTDGEVFKRTELKEVHENKCREEKPQHNFPVGKWKKYSPWKKSLRKLMET
HKKAYTGEKPFKCHICGKSFKVSSDLIKHQRVHTEERPYRCQECDKRFRWSSDLNKHLMT
HRGIKPHRCSWCGKSFSQNTNLLTHQRTHTGEKPFKCHECGKRFSQNSHLIKHQRTHTGE
QPYTCSMCGRNFSRRSSLLRHQKLHREKETVSVLILKESSKWS
Download sequence
Identical sequences F7B669
XP_007499167.1.35504 XP_007499168.1.35504 XP_007499169.1.35504 ENSMODP00000034699 ENSMODP00000034699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]