SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035429 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035429
Domain Number 1 Region: 1277-1557
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-59
Family MHCK/EF2 kinase 0.0035
Further Details:      
 
Domain Number 2 Region: 76-169
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-18
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 1206-1292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000483
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035429   Gene: ENSMODG00000019366   Transcript: ENSMODT00000037015
Sequence length 1639
Comment pep:novel chromosome:BROADO5:1:112378940:112425675:1 gene:ENSMODG00000019366 transcript:ENSMODT00000037015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSHRPPSRVWSSGLRGGVGTDGEDDGPVWNPSPASRNYLLSVRPEISLSSNRLSHPSSG
RSTFCSIIAQLTEETQPLFETTLKSRAVSEDCDARFTCVVTGYPEPEVTWYKDDEELDRY
CGLPKYEISQQGSRHTLQLYKCQEEDAAIYQASARNAKGIVSCSGVLEVGTMTEYKIHQR
WFAKLKRKAEAKMREIEQSRKYGKEMVSEADTVRKLSPDRFQRKRRLSGAREQGPSAACR
DLEDGALEPELEGESSEPPWSPAVGLANSFPGGEVTTNGDTTLESGEESGDGFLTYICEA
VELISQRPPTKESVAKKKKKEEEPSHKGLRTGEQKSEGAKPSENHIPTPAESDSGRTRGH
TEVENAPFVQREGPPKTTKLDRPDRTSESTSPLVQEARSSSKVGLKTGKGPPAPSSDGNV
YFSLKDMYLENTQPTATEERLQTPNESPQSDLPLGALPGREKLPPDQPVLPSAQQPSRVF
NRKRFAPPKPKCDPSNESQPCLSVGTPTGILSSSPQQEAQSLGSAPEPAAAVPTPPARRK
HKTQESPAQKLITHRTPCEASETQAARARAASAECLEGGQGNPEPMEVETQEEERRRRDR
RTPMDVSAQDGGRTQEDSRTCAGLRTQADVSSLAESRTQAEVKQQVVGRTRKESAGLDRR
TQAVAVTQPGGEQGLQPLAPALHTAEAPPRPSRFPSRPSPLRAEETQTPALGSRQSLPAG
LGPGGAARTAGREEGPEVGEAGPVEVDGVPPPSGEDAAGPREEAACPDPSMEGSPPGVEM
TVGSPPTPPRSTQAPSIPSSKSKQEGQARGGGLGPRASGHIEAPLPEAAPARGWSGLESQ
LGAVTPSQGQQHAAPGAAVSSRNTPGAHGELEAEVPGAGVKAPNPPAPDSGLIDSLKNYL
LLLLKLSSADTDRSETEARGRPEGQQPPAGGPGPPDTLAPTVEIAGLSPRTSRKILERVE
NNHLIQSAQSLQLSPCTSRRLTGLIDQELQSGHKALVAGRPLAKGPSPLTVPTIVVGEET
QVESPEESSWGAAQETKARPRESRIGEPLWVSGDQGSSRMGEPLRGNKGEEPFRETELSG
DNGGSLPGATPEELALGARRKRFLPKAKPSGEGEASAPEERESPTVSPRGSRKSLVPGSP
LIPPKERHSPSQSRKMLEVPRPDEDSADLGSAPKGSGPGTELAPEDGKQDEPAKPRKTKD
LFKAPQVIRKIRVEQFPDASGSLKLWCQFFNILSDSVLTWAKDQLPVAEVERSVGDEGPA
ALAIVQASPRDCGVYQCTIQNEHGTDSTNFCLSPEVLSGFISREEVEVGEEIEMTPMVFA
KGLADSGCWGDKLFGRLVSGELRGSGRGRGLRKASQAKVIYGLEPIFESGRTCVIKVPNL
LVFGSSSENSLLGRNYDVTIQGCKIQNMSREYCKIFAAEARAVPGFGEVPEIIPLYLIYR
PANNIPYATLEEYLGRPLEPYCARDWESGGSQGEPATSEAAQKCRTFQHWLYQWTNGSFL
VTDLAGVDWKMTDVQIATKLKGYQGLKESCFPGLLEQFAVSHQCNTHCEMLGLKPLKSLE
TLYPMAKAKGSKSPSSGRKAPSSTQLSPQLQKKGHPSPQGSRKSTSSLKAIPRSPETADT
HLDSQLATQERGSKAQGMR
Download sequence
Identical sequences F6ZMF9
ENSMODP00000035429 XP_007479284.1.35504 ENSMODP00000035429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]