SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036017 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036017
Domain Number 1 Region: 803-868,912-979
Classification Level Classification E-value
Superfamily Immunoglobulin 2.99e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 106-164,207-274
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 1102-1180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 1196-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000639
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 269-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000963
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 979-1052
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000245
Family I set domains 0.024
Further Details:      
 
Domain Number 7 Region: 453-533
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000435
Family I set domains 0.024
Further Details:      
 
Domain Number 8 Region: 628-709
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000615
Family I set domains 0.031
Further Details:      
 
Domain Number 9 Region: 367-455
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000822
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 719-805
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000205
Family I set domains 0.034
Further Details:      
 
Domain Number 11 Region: 545-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000649
Family I set domains 0.01
Further Details:      
 
Domain Number 12 Region: 12-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000119
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036017   Gene: ENSMODG00000016372   Transcript: ENSMODT00000037606
Sequence length 1318
Comment pep:novel chromosome:BROADO5:Un:2617998:2856045:1 gene:ENSMODG00000016372 transcript:ENSMODT00000037606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIIFIFAIAPLPKPTIVTSNNTAVETKDFSLTCNATGQIHTYRWFINGLAPGGNRIQLSQ
DKRILTIRSLTRRENKGPYVCEIQNPLFRNRSDPFTLNVAYGPDNATIVHTVNEYPVGAN
ITLSCSANSNPAAQFTWLQNGQSVSNSATFSFIATLNHAGTYTCSASNSFTGLTRTATKN
LIIYAPLSKPTILTSNITAVETKDFSFTCQGIGQIHVYWWLINGVAPAGGRIQLSPDKRT
LTIRSLTRRENKGPYVCGIENPLFSNRSDPFTLDVAYGPDIATIVHTPDVYPTGANITLS
CSATSNPPVQFTWLQNGQPVSNSATFSFIASLNHAGTYTCTASNSFTGLTRNATKNLIIY
APLSKPTIVTSNITAVETKDFSLTCQATGQIHTYRWFINGLAPSGSRIQLSPDKRTLTIR
NLTRRENKGPYECEIQNPFYSNRSDPFTLDVAYGPDTATIVRTVDEYPIGANITLSCSSK
SNPPVQFTWLHNGQPVSNSATFSFTASLSLAGTYTCSAANSFTGLTRTATKNVIIYAPLS
TPIIVTSNNTAVETKDFSFTCQATGQIHTYRWFINGLAPAGSRIQLSPDKSTLTIRRLTR
RENKGPYVCEIKNPFYSNRSDPFTLDVTYGPDTATIVRTVDEYPIGANITLSCSATSNPP
VQFTWLQNGQPVSNSATFSFIASLSLAGTYTCSAANSFTGLTRTATKNVIIYAPLSKPTI
STSNIAPVENKDFSMTCQATGQNHTYRWFINNRAPSGSRLQLSPDKRTFTIRSVTRRENK
GPYVCEIKNPFYSNRSDPLTLNVTYGPDTPVIVPTIDAYPIGANITLLCSAVSNPPAQFN
WLYNGQQVSNSATFSTITFLSQSGTYTCHASNSFTGLQATKDMNITIYGPLSRPIINSPN
RIPVENIDTVSLTCNATGQVRTYQWFINNRAPTDNRIQLTRDKRTLTVGSLTREHEGSYV
CEIKNPFYSNRSDPFKLNVYYGPDNAIILPKVDRYLVGTNITLSCSAKSKPPAKFIWFHK
GKKWRPSAKLSLTNVSLKHAGTYICQAFNSHTGLNSIKDKNLTIYVEEKNFTDSEEKNVK
INAEFTMYENLLSPSKINNTGFVIENGTAILTCNTEGYGLPDVWWYYKNKRMVLNDRMTL
SNFDQTLTITPAKREDSGAYRCEIWDPFLVYRSPLFNLVVCYGPEKIKIFPNSVNGQIEV
TLKENLTLGCQATSEPPAQYTWQINGSSIAVNSGNNYTIYRASWDHAGTYTCIAINDMVN
ATISKNIRVRVIEKEAHTLSGGAIIGLVIGFLAVVVLIGALVYFLFIRTSSGPQYFYQ
Download sequence
Identical sequences M9MMJ1
ENSMODP00000036017 ENSMODP00000036017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]