SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037366 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037366
Domain Number 1 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.08e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 634-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 56-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 7 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 334-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 250-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 394-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-18
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 11 Region: 596-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 12 Region: 735-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-17
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037366   Gene: ENSMODG00000025207   Transcript: ENSMODT00000038963
Sequence length 790
Comment pep:novel chromosome:BROADO5:8:35801463:35809713:-1 gene:ENSMODG00000025207 transcript:ENSMODT00000038963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLGERASPLSKPSRLHSSQDSSRGASEEPEARAAFLGPSRGRQRGPEWPGRLPAMPQR
PVTFGDVSVDFSRDEWRRLSPAQRLLYRDVMLENFGNLVLLAGLAVSKPELIRRLERGEA
PWLPGRGASRAASAHSQETRCDGDSLTSKQGICVGATSKERMDKNWYFKMGETWEDDSRS
GRQKCNQERQSKQVTGNNRKPFNKVSVPEGNTLGRSLNLGTVFITQPRSPTGKTFSKRSY
RTQRQKIRNREKRYICNECGKAFSQWGSLIDHLRIHTGEKPFQCNECKKTFSQRGTLIRH
HRIHTGEKPFECHECGKAFGNNSCLTLHQRIHTGEKPYICNECGKAFSGRQNMIHHQRIH
TGEKPYQCKECGKDFRHRASFVCHQRMHTGEKPFCNECGKAFRRKENLTAHKRIHTGEKP
FECNECGKTFSNNSCLTLHQRIHTGEKPYKCNDCGKDFRHRASFTYHQRVHSGNKPYSCK
ECGKAFSQRANLIEHMRIHTGEKPFECYQCGKAFINNARLTVHQRFHTGVKPHACNECGK
AFMHKASLTAHQRIHTGEKPYKCNECGRAFNQSAHLMRHQRIHTGEKPRKPSAQNLYHCE
ECGKGFRQKSYLSLHQRIHTGEKPYHCNECGKAFIGRGQLNTHKRIHTGEKPFECSDCGK
AFSRKEHLTAHERTHTGEKPYQCKECGKTFSQNSHLTVHQKTHTGEKPFLCNDCGKGFSY
RTSLISHQRIHTGEKPFECSVCGKNFSHRPSLIKHQIIHTGEKPFDCLKCGKNFTHRSSF
IKHQRIHNGE
Download sequence
Identical sequences F7BFN1
ENSMODP00000037366 ENSMODP00000037366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]