SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037760 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037760
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily L domain-like 3.06e-42
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 2593-2686
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-20
Family I set domains 0.05
Further Details:      
 
Domain Number 3 Region: 2001-2100
Classification Level Classification E-value
Superfamily Immunoglobulin 6.07e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 1905-1998
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-19
Family I set domains 0.0084
Further Details:      
 
Domain Number 5 Region: 2406-2490
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 2097-2192
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 2784-2880
Classification Level Classification E-value
Superfamily Immunoglobulin 9.34e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 2204-2295
Classification Level Classification E-value
Superfamily Immunoglobulin 9.91e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 2304-2400
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000126
Family I set domains 0.052
Further Details:      
 
Domain Number 10 Region: 2690-2786
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000945
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 11 Region: 586-674
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000539
Family I set domains 0.039
Further Details:      
 
Domain Number 12 Region: 495-581
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000043
Family I set domains 0.056
Further Details:      
 
Domain Number 13 Region: 2515-2591
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000607
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037760   Gene: ENSMODG00000000020   Transcript: ENSMODT00000039365
Sequence length 2881
Comment pep:novel chromosome:BROADO5:7:46438099:46474562:1 gene:ENSMODG00000000020 transcript:ENSMODT00000039365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSDKMQKATLEALSVVLILFWGHPQDSLACPHPCACYVPTEVHCTFRSLASVPARISRH
VERINLGFNSIQSISEDSFAGLTKLELLMIHGNDIPNIPNGALKDLISLQVFKFSYNKLR
VITAQTLKGLSSLMRLHIDHNKIEFIHPQAFNGLTSLRLLHLEGNLLHQLHPSTFSTFAF
LDYFRLSTIRHLYLSENAIKTLPVGMFSNMPLLENLYLHGNPWSCDCGLKWLLEWDARSR
GILKCKKDKAYEGGQLCSACSSPKQLNEQEIFSLKDILCTKPVIQSPLKQNFSSSSNEEV
GEDDDDEEDSSVSLEEIQFSPWNITLNMTDEHGNTVNLACEIKKPTDVSKIQLNQSDPQE
IDINATIALELQCPMNRENYEKLWKLIAYYSEVPVTLQREVILSKDPKVSYQYRQDTNDD
ALYYTGVKAQILAEPAWVMQPSIDIQLNRRQSTAKKVLLSLYTQFSQIIPMKDLRQQRSK
SWVMIEQDEKVKAAQTVIEGSVCYLNCNVKASESPTLLWVLPDGSMLKAPLNDQDSKFSV
LSSGQLIIKSAGHSDSGLYQCIAQVRDEMDRMIYRVSVQPPIIQPTRRHIVTIEKNYEEP
LILPCSALAIPDAELSWLLPDKQILNGLSNSTNAYMLENGTLFIPSSKSSDSGYYKCIAI
NQQGADHLIVKVTVNKKGANKSSKRGQLRKRPGSKTTSKIRDNVIEDEGGSGIEETDNSA
RRMLNPKDQEEPSKRRKDAVSGTEDKKNKKGRRKMKHWKGLERAPETNVAEGRRVFESRR
RINMANKQINPQHWADILAKVRGKNLPKSTAVPHSDSVIKTTIASSVRQKTTLPPPISSP
PLKSAVQTTPNTEESSASESLFGEDELVSVTISPTNTDQSDSRNLAEANMHVEKSIAHGA
LETPKPTYVAETPSTWIDPTITTFLPSKSTYFEPSLNHFPKNPINEEITESWSTVDSIDF
SVGSTSNQGELPLDTIILAESETVTYLYPGLKTDSQFSKGYSEDPTSIQFIPIRPDGVSD
FDVPKTGSNDLDPAALPFEDLLSGDHNIPIHQQPQVKTKKVQSTVNRVHTHDNSSVHQDN
DGEYETNQEEKLEKVTTNNRISERARQSASSATVSDFSYNVLTTAVPLQKPEQMTSTTTT
EELTTTAAVTADSKNISSSSLITQQSRRRPHGRKRLRHHKLHRKRPIMPTAFAIAEPSLS
PIILVTEPKIANKIDISLVSFAPWVENKTTIPKQLERKKYVETVTKGGSRRKHPKRPKLN
QVTTTTVSSFETESETTTKKLVIPTTAIKQTVGLLATTAPLTMEVLHKKRTKENITTIPP
ATEIHSSHHEVEQETTSYMYKNLFNVDSDNKGIENDYGVTDSNAFETRTVGSSESLSGVV
SPSDLVDSEVTEFKKEFLGLEFSSTPSWQPKRVVQFTVPPVKDPSVPITTSQKSSEDSLI
FKESPFPSKFAALTEVPDSSQHEEKYTSYVPPTRKKEYPSPQVEIISQESPAEQDHKKTS
LAVTHSIIALDNHTVTPKPSKQITSTIPPFPSLMEQMASPIALLPSAESTTAPSLLFSST
SSTSTQMPMKSKENTIFNHVGSPESKISEIDAKKRKPVFSPNEFPTPSFNQNRINLPSKK
EQFKEIQGSSSNNQLLQGSDPPYHPGRMPIFNQKPAIVPGKHVTPRVTIRPPHITTQGLY
QHFITSQPFFPFTNKPEITSYPSQNGPYKRLPSMPTLTTATTVIPLPRPNPIFPSTSGHP
GTNHFNANPKVFGNNYIPEQKGSAVKVPSHKIPYTANGRFPFLFNRTPTFTQLGVTPKPP
TTILPISVNTREKQIIPGPYIQISTPGTIHNVIGTSRAPSIFHTPSTRSTPLVNFKNTSP
VFPTRRTIPHSASTIHSYRNFHHSNSKITFSGGPPAPSFWALGEKPHIITKSPHTLSIIT
ETDVVLPCDATGEPKPFVTWTKVSTGALMTPNTRTQRFEVLKNGTFIIRDVQLQDRGQYM
CTAKNLHGVDKMIVTLSVTAQQPQILASHYQDVTVYLGDTIAMECLAKGTPPPQISWIFP
DRKVWRSVSTAEARIMLHENRTLTIKEATFSDRGVYKCIANNAAGADSLAIRLHVVALPP
IIHQERQENISLPPGLSIHIHCTAKAAPLPSIRWVIFDGTQVRPSQFINGNLFVFPNGTL
YIRNISPKDSGNYECVAANMVGAARRMVHLNVQKTSANAKIIGSSPHKTDITYGGTLRLN
CSASGDPWPRILWRLPSKRMIDSLFSFDNRIKVFGNGTLIVHSVTDKDAGDYLCIARNKI
GDDYIVLKVNVMMKPAKIEHKKENDHKVIYGGDLKVDCVATGFPNPEISWSLPDGSMVNT
LMQSDDSGGRTKRYVVFNNGTLYFNEVGMREEGDYTCFAENQIGKDEMRVHVKVVAEPAA
IHNKTYSVIHVPYGDVVTVACEAKGEPTPKVTWLSPTNRLIPISSDKYQVFRDGTLLIQK
AQRSDSGNYTCVVRNSAGEDRKIVWIHVNVQSPTINGHPNAITTVREVAARESRKLIDCK
AEGIPAPRVLWAFPEGVILPAPYYGTRITVHRNGTLDIRSLKKTDSVQLVCIGRNEGGEA
KLIVQLTVLDPLEKPVFRNPVSEKITAMAGHTINLNCSAEGNPEPSIVWILPNGTELQSG
KHLQRFYHKKDGMLHISSLSAADAGAYHCVARNKAGYTERLVSLKVGLKPEISNQYQNLV
SIINGETLQLHCIAQGSQKARVSWTLPSGMVLEGPQVVGRFSLLENGSLTVHEASVFDRG
TYMCKVETEYGSSVMNVPVIVIAYPPRITSEPTPVIYTRPGNTVKMNCMVIGIPKAEITW
ELPDKSHLTAGPQSRLYGNKFLHPQGSLIIQHSTQRDAGYYKCTAKNILGSDSKTTYIHV
F
Download sequence
Identical sequences F6ZB03
ENSMODP00000037760 XP_001362582.2.35504 ENSMODP00000037760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]