SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038324 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038324
Domain Number 1 Region: 19-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-78
Family Eukaryotic proteases 0.00035
Further Details:      
 
Domain Number 2 Region: 436-541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-29
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 3 Region: 312-418
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038324   Gene: ENSMODG00000025535   Transcript: ENSMODT00000039924
Sequence length 546
Comment pep:novel chromosome:BROADO5:5:241505183:241537952:-1 gene:ENSMODG00000025535 transcript:ENSMODT00000039924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLILLLGMFHFGVGKYTFQSLLRGPTCGRSTLDNQPWDYFGHFSRIVGGSPVEKGTYPWQ
VSLKRREKHFCGGTIISAQWVITAAHCVIHKDAKKILNVTAGEHDVNLVEQGEQTLSVDT
IIKHPYFTLRKPMNYDIALLKMNGTFKFGQFVGPLCLPKRGEIFEPGFFCTTAGWGRLEE
NGRLPQVLHQVDLPILTKKKCAAMLLTLKRPIKGNTLLCAGFPDGGKDACQGDSGGSLMC
RNRYGAWTLAGVTSWGMGCARSWRHNRKKIASYRGTPGVFTDLSKVLPWIHNTIEMGQRM
KSFVALCSEQDGQLPGSEGQLHFPRRPHQFYGSDELCVWTVHVMGQMHIWLNFSHLDVEF
EEFCRLDSLSVYSLEDRLIGKFCGVIVPSPIFISSNSVRLKFVSDATEYGTGFALTYKGL
KPNHSPDSGCVALTVLFEEGIIQSLHYPDVYSNLINCRWIIHAFEDHIIKLEFQNFELEE
SDDCLSDSVTVYDDVEGKEETARYCGFDVPQPVLSSSSVMLISFQADESRVFRGFQATIS
FISEAG
Download sequence
Identical sequences F6V1G4
ENSMODP00000038324 ENSMODP00000038324 13616.ENSMODP00000038324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]