SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038501 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038501
Domain Number 1 Region: 490-582
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000235
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 316-394
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000405
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 35-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000769
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 223-314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000268
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 397-485
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000325
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038501
Domain Number - Region: 95-202
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00643
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038501   Gene: ENSMODG00000025673   Transcript: ENSMODT00000040101
Sequence length 726
Comment pep:novel chromosome:BROADO5:2:230069675:230169548:1 gene:ENSMODG00000025673 transcript:ENSMODT00000040101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLVLLGMLWFCPSLKGQENSFTINSIEIKAEPGWEVENGKNLTLNCLFDISATSKLQSP
RRVLFYKDDILIKNVTSWNKKESFFIQAARLYDRGNYKCTVILNNKEKTTKDYSVSVKGV
PSPRITVDKIEVMEGGVVKVGCSVPEEKPPIYFIIEKLDMHVFKQRKEKMKLHENFVTLD
FPIEERDHVLVFQCQAKISFGSFLEASEFSRSDWVTVREPFSIPKFQITPEGEITEGDPL
KLECTILVAPMFLEEPEIIIQKGREILASAKHGTEVSYTPSLAKVEHIGNYTCKVESGKI
SKVNSVFINITELFSKPELLVSSNHLDEGGKLDLSCQIEGSLPANFTIQKENTTIINSQN
FTKRVWVHDSGTYRCLGTIHNVIKESDPVQISVFEIVSKPKIFHNSASEVITGKLLEIYC
QSTNGTPPIMYYLCKMNLCANQKEMYSNEPVKFLDTPTANTEYTCIAKNHHSQGTMDSDV
LNVVVIAPVAKVNLSILLHEEVVSGKEVVLRCSTDGGSWPIHYKFYRHNSMVPFATITLN
DTQAIWHTLQARKEDEGQYYCTASNRANIHSGVPKSNIITIKVALAPWMKSLIAVVIIGA
IITALVLLIRWYFKKTKAKQMPVEMSRPEPPLNSNTEKIQSDTNVEANSHSGYNDDIGNH
TVKPTNEHKEPDHLKMDVEYTEVEVLTPDLPRAPERKGTDTVYSEIRKADSGENRHSRIE
GSLDAT
Download sequence
Identical sequences F6U0Z2
ENSMODP00000038501 XP_007482856.1.35504 ENSMODP00000038501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]