SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038704 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038704
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SEA domain 1.83e-22
Family SEA domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038704   Gene: ENSMODG00000028516   Transcript: ENSMODT00000041812
Sequence length 100
Comment pep:novel chromosome:BROADO5:Un:59331853:59334333:1 gene:ENSMODG00000028516 transcript:ENSMODT00000041812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHRDSGTFKAAENVIKVLLKSVFAMTNLGSHYSGCSVILLRPLKNGTATGVDVLCTCQE
DSSNPVLDKEKVYWELSEQIYRRNLRHLLIERDSLFVDGK
Download sequence
Identical sequences K7DYV3
XP_007506834.1.35504 ENSMODP00000038704 ENSMODP00000038704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]