SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039298 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039298
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 89-150
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-20
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 7 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039298   Gene: ENSMODG00000003524   Transcript: ENSMODT00000042408
Sequence length 637
Comment pep:novel chromosome:BROADO5:4:406031530:406051692:-1 gene:ENSMODG00000003524 transcript:ENSMODT00000042408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWVRVSRVSVSIHHFKGLPQRDKHGSAGVRRGGSVWNPSLGGALPSPRGVQSGSLPTL
GLPPPEGHSLSGAETPEPEGMAPRTPRLPSQGSITFKDVVMDFTKEEWCLLDISEKELYK
EVMLENVQNLLSVGLIVPKENFITCFQQGESPWLLKQKGQWSSCPEAETNFEVKEICTNL
RLFMEGSDPQRCMNEGPCDFILREICHSGIKVNKNPMSECEFDETAEKFSQYSVLNQYMK
LTLGNDSSQDNEYSSCFPEEVGFIQLQEKSPEIIMYQGHIGEMAFGWSLDLIRHPKSKYI
DILSVNNKVGRPFSQNSELGSHQIIHTGEKPYECKQCGKAFTVKSNLNRHERIHTGEKPH
ECKQCGKAFTRKGHLARHLRMHTGEKPYECKQCGKAFPRRNRLASHQRIHTGEKPYECKQ
CGKAFTQRNYLAAHQTIHTGEKPYECEQCGKTFTERASLGAHQRIHTGEKPYKCTQCGKA
FTQRGHLTAHQAIHTREKPYKCKQCGKAFTLRGSLGAHQRIHTGEKPYECKHCGKAFTEK
GSLGAHQRIHTGEKPYECKYCGKAFTMRGSLGAHQRIHTGEKPYECTHCGKAFTMRGSLG
AHQRIHTGEKPYECTHCGKAFRNSSDLCKHQRIHTGE
Download sequence
Identical sequences F6TT81
ENSMODP00000039298 ENSMODP00000012588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]