SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039436 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039436
Domain Number 1 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 511-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 54-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-22
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 7 Region: 610-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039436   Gene: ENSMODG00000028607   Transcript: ENSMODT00000042542
Sequence length 673
Comment pep:novel chromosome:BROADO5:4:402182296:402215915:1 gene:ENSMODG00000028607 transcript:ENSMODT00000042542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGSPFEPSPSLSPQVHTEDVSPLGAATPRSTPGWPRREPSARGMAPGTPRPPSQGFIT
FKDVVVDFTQEEWCLLEHSQKELYREVMLENVQNLLSLGLLVPKEDFISSFQQGDGSWLL
QQKDSKTKNKQKGSRSSSPEAETNFEVNKMSTKLSHFVEGYGLQRCTTEGLSDFILRKIC
NSNIKGNENPKTNYKIDGTAEKFSKNSVLTQYTKLTSGNDCSQDSRYSKCFPAELDLIQL
AEKPLEMPLHQSNLGGMAFGSSLDIIRHPKTKHVEMVSMSNEDGRSFSQNSELDSYQIIH
CGEKPYECKQCGKSFKCRDTLASHQRIHSGEKTYECKHCGKVYKHKNILVVHQRIHTGEK
PYECKQCGKAFTQRSYLAAHQRIHTGEKPYECKQCGKAFTQRGHLFIHQKSHTGEKAHKC
KRCGKAFTMRSHLTRHQKIHTGEKPFECEHCGKAFKARNILVTHQRVHTGEKPFECKQCG
KAFTWKESLSSHQRIHSREKPYECKQCGKAFKGRDYLATHQRFHIGEKPYECKQCGKAFT
MSGSLARHQKVHTGEKPYPCKQCGKAFTERVDLAAHQRSHTGEKPYECKQCGKAFTGRNS
LVVHQRSHTGEKPYECIQCGKAFTGRNSLVSHQRIHTGEKPYECIVCGKAFTRSGTLARH
QKIHTREKPYECR
Download sequence
Identical sequences K7E0Y5
ENSMODP00000039436 ENSMODP00000039436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]