SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039647 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039647
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily SEA domain 1.2e-16
Family SEA domain 0.0045
Further Details:      
 
Domain Number 2 Region: 93-176
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000196
Family SEA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039647   Gene: ENSMODG00000028823   Transcript: ENSMODT00000042753
Sequence length 185
Comment pep:novel chromosome:BROADO5:3:462221151:462231213:-1 gene:ENSMODG00000028823 transcript:ENSMODT00000042753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNRTATGVDVDCAYHEDYSIPVLDREKIYWELSEQTHGITRLGPYMIDNESLYVDGYNH
LAVAPTKMPPDPAVAPGCPLWATEPGGSQAASLSFQSFTTIPKVLYTEDMHLSGSDKFNS
TNRILQRLMKNGSESGVSDLCTHRRNPRSSDGNQEKVHWELSNKKKHITKLGLSSSLEKG
QSTQC
Download sequence
Identical sequences K7E1J6
ENSMODP00000039647 ENSMODP00000039647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]