SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040175 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040175
Domain Number 1 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.19e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 119-179
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 7 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 663-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040175   Gene: ENSMODG00000028902   Transcript: ENSMODT00000043277
Sequence length 728
Comment pep:novel chromosome:BROADO5:3:500053671:500078135:1 gene:ENSMODG00000028902 transcript:ENSMODT00000043277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPESDMALRCEGLHFPECLTQTCKSGPSAVQDSISQNAVFLTPPQPRLLPPVAVSEHAGS
LLWASSAPGSCTTAFLGPLLGAPRGSLPPLGLPPPRSTPGWPCREPAARGMAVWTPRPPS
QGSITFKDVAVDFTQEEWCLLDHSQKELYQEVMLENVHNVLSVGLPVPRENLIFCFQQGL
APWLLEQKGPRISCPEAETNFEVKEMCTKLSLFEEGSDAQRCVNVGPCDLILREICNSNM
VQKHPRNDSEFDDTSKKFNQYSVLNEYVKLTSGNDTFQDSKYRKPFPEEVGLVHSPEKPP
EMSLYQGNLGGMTFGWILDLFRHSKHKSVAMFSASDKGDRRFTQNSELTEHQGIHTGGKP
YEFKQCGKAFIQSSKLAEHHSIHTGEKPYECKQCGKAFTQRGNLAAHQRIHTGEKPYECK
HCGKSFTQRISLTRHQRIHTGEKPYECKQCGKAFTQRSKLAAHQRIHTGEKPFECQHCGK
AFTERGSLVSHQRIHTGEKPYECKQCGKSFTVRVSLTAHQSIHSGEKPYECKHCRKAFTQ
RSSLVSHQRIHTGEKPYECKHCGKSFTQRISLTRHQRIHTGEKPYECKQCGKTFTQRSNL
AAHQRTHTGEKPFECQHCGKAFTERGSLVSHQRIHTGEKPYECKQCGKSFTVRVSLTAHQ
SIHSGEKLYECKHCGKAFTQRSSLVSHQRIHTREKPYECEHCGKAFIRRVSLTRHQRIHV
GEKHHEYE
Download sequence
Identical sequences K7E324
ENSMODP00000040175 ENSMODP00000040175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]