SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040414 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040414
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-53
Family DBL homology domain (DH-domain) 0.0000994
Further Details:      
 
Domain Number 2 Region: 330-408
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000554
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040414   Gene: ENSMODG00000028257   Transcript: ENSMODT00000043520
Sequence length 414
Comment pep:novel chromosome:BROADO5:5:66993921:66995624:1 gene:ENSMODG00000028257 transcript:ENSMODT00000043520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEIGSFLPIKRTIRVLDVNNQSFREQEEPSNKRVRSLARVSSLANLISPVRNGAVK
RFGQTIQSFTLRGDNRSPACAQKSFNRATVPTPSKRRNSVRWSEMLDINMKESLTTKEIK
RQEAIYEMLRGEQDLIEDLKPARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RLGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAANALLDQKKQDARVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHTDIKPLEEALLVIQGVLSDIN
LKKGESECQYYIDKLEYLDDKQKDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTR
PVIRNERHSYQVYRQPIPVKELVLEDLQDGDVRMGGSFRGAFSNSDKGKEKSFR
Download sequence
Identical sequences K7E3R2
ENSMODP00000040414 ENSMODP00000040414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]