SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040532 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040532
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-26
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 101-161
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 260-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 527-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-20
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 221-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000811
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 349-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000023
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040532   Gene: ENSMODG00000029130   Transcript: ENSMODT00000043638
Sequence length 573
Comment pep:novel chromosome:BROADO5:3:502260255:502282003:1 gene:ENSMODG00000029130 transcript:ENSMODT00000043638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAVPSRPSPASQKARMQRPRGKRRAPSCVRREKSWELGTPEAPAAFSVFPKARRSERP
KRQGQEKMKEELHQMDSLRLLCCLYREPGIPRMALETDRLPAQEAVMFKDVAVDFTREEW
RLLSPPQKLLYKEVMLENARNLLSVGLQAPSDDVFSSLEQREAPWMLEQEVLRSCCPGEI
KPEMKLTPTEVSLSVEKMNLQRFISDGHDNFPFRKFCFAPQNSSHIEHQRIHTEEKCSKS
NQCRKTFMHRATRVGHQRMHNGEKPYECKECGKKFSQSCSLAKHQRIHTGEKPYECNQCG
KTFSRSCNLAVHQRIHTGEKPYECNQCGKTFNQRANLARHQRIHTGENPYECNQCGKTFS
RSSHLAAHQRIHTGEKPYECKHCGKTFKENSNLAAHQRIHTGEKPYECKQCGKTFRLRSS
LAVHQRIHTGEKPYECNQCGKTFTDNSSLAVHQRIHTGEKPYECKQCGKTFTDNSNLAVH
QRIHTGEKPYECKECGKTFSRRSHLAVHQRIHTGEKPYECKQCGKIFRNYSNLAVHQRIH
TGEKPYECNQCGKTFSCSSNLVVHQRIHTGEKP
Download sequence
Identical sequences K7E430
ENSMODP00000040532 ENSMODP00000040532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]