SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000011 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000011
Domain Number 1 Region: 207-289
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000977
Family Canonical RBD 0.000055
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000329
Family Canonical RBD 0.0029
Further Details:      
 
Domain Number 3 Region: 66-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000231
Family Canonical RBD 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000011   Gene: ENSMODG00000000008   Transcript: ENSMODT00000000011
Sequence length 338
Comment pep:novel chromosome:BROADO5:4:261827928:261829022:1 gene:ENSMODG00000000008 transcript:ENSMODT00000000011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPSGEAFVELESKDEVKLALKRDRETMGHRYVEVLKSNNIEMDWVLKRIGLNSPDTASD
GSVHRGLPFGCSNEKNYFFSGLEIVSNGIALPMDFQGGVGEAFLQFASQKITEKALKKPK
KRIGHSDIEIFKSSWAEYPGPYNRSGAGRGHNSIGRGAGFERMREISMGGYDDYIGYNDG
YGFGSDRFGRDLNYYFSGISDHRYGDSGCSTTGHCVHMRGLPYQAIENDIYNFFLTTQLC
VHIEIGPDGRVIGEADVEFATHKDAVAAISKDKANMQHRYEEIFLNSTAGASGGTYGSQM
MGGIGLSNQSSYGGPASQELNGGYGGEYNGHSSMSGYD
Download sequence
Identical sequences F6SIJ1
ENSMODP00000000011 13616.ENSMODP00000000011 ENSMODP00000000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]