SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000087 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000087
Domain Number 1 Region: 168-246
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000305
Family Canonical RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000087   Gene: ENSMODG00000000082   Transcript: ENSMODT00000000089
Sequence length 644
Comment pep:novel chromosome:BROADO5:7:49096754:49141724:-1 gene:ENSMODG00000000082 transcript:ENSMODT00000000089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATIVHDTSEAVELCSLYGLYLKPITKMTISVALPQLKQPGKSISNWEVMERLKGMVQ
SHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKID
FPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPNEEVLIKVFET
FGEIRNVDIPMLDPYREEMTGRNFHTFSFGGHLNFEAYVQYREYVGFIKAMNALRGMKLM
YKGEDGKAVACNIKVSFDSTKHLSDASIKKRQLERQKLQELEQQREEQKRKEKEAEERQK
EEERKQKELEELERERKREEKLRKREQKQKDREVRRNQKKLEKIQAEEQKKLQEKIKLEE
RKLLLAQRNLQSIRLIAELLSRAKAVKLLEHEQKEEKIRLQQLEERRRLQEAELRRVEEE
KERALGLQRKEKELRERLLNILLSKKIDETQQSKEEAVASHSALLQPVIDIIQSVSSSCV
TSTSLHSLMGQPTQICQREMLSNQEINFNSKNVNGNLSEEAQCKESKKLNCITSESCTEK
RCSGVLSCLPANNQQQKGTSNCDQNVSKKESSSEQDKCNREPSKGKSRSSRDRSTEERHK
RDRSKHRRDASKEDERQRKERRLHRRHSYKDSSPHRRSIRKLRQ
Download sequence
Identical sequences F6QSW2
ENSMODP00000000087 ENSMODP00000000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]