SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000137 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000137
Domain Number 1 Region: 193-353
Classification Level Classification E-value
Superfamily SET domain 6.15e-40
Family Histone lysine methyltransferases 0.0000000898
Further Details:      
 
Domain Number 2 Region: 54-181
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.27e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000137   Gene: ENSMODG00000000122   Transcript: ENSMODT00000000141
Sequence length 365
Comment pep:known_by_projection chromosome:BROADO5:5:140354321:140412366:1 gene:ENSMODG00000000122 transcript:ENSMODT00000000141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDDEMVEEAVEGHLDDDGLPHGLCTVTYSSTDRFEGHFVHGEKNGRGKFFFFDGSTLE
GLYVDDALQGQGVYTYEDGGVLKGTYADGELNGPAQEYDSDGRLIFKGQYKDNIRHGICW
IYYPDGGTLVGEVNEEGEMTGDKIAYVYPDGRTTIYGKFIDGELIEGKLATMSVEEGKPY
FELIPGSSLYHFDKSTPSCISTNPLLPDPYESERVYVADSHIPSAGEGLFSKVAVGPNTV
ISFYNGIRITHQEVDDRDWDLNGNTLSLDDETVIDVPEPYNHTSKYCASLGHKANHSFTP
NCIYDVFAHPRFGPIKCIRTKQAVERDEELTVAYGYDHNPPGKSMPEAPEWYRMELKVFQ
AAQEK
Download sequence
Identical sequences F6YBN1
XP_007496366.1.35504 ENSMODP00000000137 ENSMODP00000000137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]