SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000175 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000175
Domain Number 1 Region: 54-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-22
Family Canonical RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000175   Gene: ENSMODG00000000152   Transcript: ENSMODT00000000179
Sequence length 314
Comment pep:novel chromosome:BROADO5:4:118178009:118193711:1 gene:ENSMODG00000000152 transcript:ENSMODT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQCSNDMAEATATRTASASKSANTVPKELLSLDPKLQTEFQKRVASVRKRGANKPEKL
TPGVVYLGHLPRGLYEPQLKEYFTQFGTVKRLRLSRSKKTGNSKGYGFLEFESDDVAKIV
ADTMNNYLFCERLLKCHFVPPEKVHEELFKGCEIPFSKPSHPAVKRYNKERTYEEKIRME
KRFKKKENKLRKRLAEKGIDYTFPKLVLRNRRKKKVAGTTSLQKTVDNEELPKKEKMNVS
DTALDTVDSQGATPICSPTFLERRKAQAAEMNDDDDDNEIIFKLPPIINKKGTPLTQTPP
SSRRKKAKNNKGLS
Download sequence
Identical sequences F6XSZ6
ENSMODP00000000175 XP_001364752.1.35504 ENSMODP00000000175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]