SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000180 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000180
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-37
Family SCAN domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 216-260
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000012
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000180   Gene: ENSMODG00000000157   Transcript: ENSMODT00000000184
Sequence length 373
Comment pep:known_by_projection chromosome:BROADO5:2:246510343:246666978:-1 gene:ENSMODG00000000157 transcript:ENSMODT00000000184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTALGSLIPSSPLMKPEGDYFSGQNFDLRGDNPETARQHFRQFHYQLMSGPHETMRQLR
KLCFGWLRPEIHSKEQILEMLMLEQFLSILPGEIQTWVRKQCPKSGEEAVTLVEGLQKDP
GKLWQWIKVQVLGQEAVSEEMESPDISMEPHAKVMLLEEGIQNSHSALEEQLNYSIKEES
DNSLEFGLAVSHLPTLPEGSPTSDNNEAASLLTPGSQEQWQYLNHIQKEIYWDAMLEDYG
KVVSLGIPVSKPDLTNLVDRREKLDGSHSLANEEIPRNICIGDRRENDKENLHLENIKVQ
ESQKICFQQTSEKDALGNDVTIRRSCRLSTHEDSELMMTALAMLFQLLLKGSKPFGYQMD
VLARRELFFYALC
Download sequence
Identical sequences F6XSI5
ENSMODP00000000180 ENSMODP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]