SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000191 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000191
Domain Number 1 Region: 128-328
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-34
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000191   Gene: ENSMODG00000000164   Transcript: ENSMODT00000000195
Sequence length 524
Comment pep:known_by_projection chromosome:BROADO5:1:198199703:198222958:-1 gene:ENSMODG00000000164 transcript:ENSMODT00000000195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSSDYHFLNQILGRRVKITLVCGIFQGVLQHVDPSKIIVLKKVKNLETGRSVPGVKMF
FGHEIVNVELLDDMEQGIGEKPPSVRDCLNTEGTRMDKVKEADQSINDSASSSLESHTIT
LLNDLKYSPSEEEDVMYTVVNQFQQKFGSAMLHIKKQSVLSVAAEGVNLCRHGKLCWLQV
ATSSRVYLFDIFLLGSRAFNNGLQMVLEDRKILKVIHDCRWLSDCLSHQYGIVLSNVFDT
QVADVLQFSMETGGFLPHCISTLQESLIRHLKMSPKCVSFLDDKQKMVQENPEIWFVRPL
PPSLLKVLALETTYLLPLRLLLLDEMMSDLTTLVDAYLNTYREGSGDLLGGTEPSCMELP
EELRQLMDFQRLRRERAMKDYKTNAEGLLVRSQLIYPKEKTVEEEGKPKSSRGSLPFEGA
MLPKALDLGYLKPQQAQEDRSLQKQETKYDSKQVRIKHQHSSSSEEPETGDSAAKAGPSC
FGLKGSKDVKGTRKEQTDTPKQTQSSLSLQEKIELLLMGGKEDD
Download sequence
Identical sequences F6XAA5
ENSMODP00000000191 XP_016283180.1.35504 ENSMODP00000000191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]