SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000258 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000258
Domain Number 1 Region: 446-857
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-115
Family PIWI domain 0.0043
Further Details:      
 
Domain Number 2 Region: 108-429
Classification Level Classification E-value
Superfamily PAZ domain 1.88e-73
Family PAZ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000258   Gene: ENSMODG00000000217   Transcript: ENSMODT00000000262
Sequence length 857
Comment pep:known_by_projection chromosome:BROADO5:4:264320788:264378314:-1 gene:ENSMODG00000000217 transcript:ENSMODT00000000262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRARVRARGVYRSSESRLSGQSQSSAWSHLAARDREAATSSGLLGIKRIPQKSEEGIS
AGDGAECTLVQRGGRTQHRNFLELGIHTREKLEHVKDCKTGTSGAPVKLVTNIFNLALPR
EWHLFQYHVTFSPELASKRLRIALLCSHSKFQKKAKVFDGSILFLSEKLEEKVTTLSGET
RPGICITITVTLTSELPSCSPVCIQFFNIIFRKILKKLSMYQIGRNFYSPVDPVEIPQHK
LSLWPGFAISVSQLENKLMFTANVTHKVLRNETVLEFMTDLYNRKDKSRFIETCEKELLG
SVVLTRYNNKTYRIDDIDWSVKPTDTFQKRDGTRITYFDYYKQQYDIKLSDLNQPMLVSQ
LKRKGTGNEEARIAHLIPELCYFTGLSKRMTSDFRLMKDLATNTHLNPLLRQQRLSRLAD
NIQRNKEARFELETWGLQFGCQMSLTGRVVPSEKILMQDTICQPMSSANWSKDMRNCKLL
GARALNNWLIVCSHRNEDVAENLLNCLRRVSGPMGFHIEKPKITKVQENTTAFIRAIQQH
TNLDLQLVMCILPSNQKDCYDSIKRFLSLDHPVPSQCVLARTLIRQGMMMSIATKIAMQM
VSKLGGELWAVEIPLKSLMVVGIDVNKEACAKGRSAVGFVASSNSRITRWFSRCILQNTK
TNIADCLKVCMKGALDKWYRYNHCFPTRIIVYRDGVGDGQLQTIVDYEVPQLLSSLRDSN
PNYSPKVSVIVVRKSCMPRFFTEMNSTLQNPPLGTVVDSEATRPEWQVYMYDFYLISQAA
YQGTVTPTYYNVIYDDNGLKPDHMQRLTYKLCHLYYNWPGLIKIPAPCQYAHKLTFLVGQ
SIHREPSMELADYLFYL
Download sequence
Identical sequences F6SZK3
13616.ENSMODP00000000258 ENSMODP00000000258 ENSMODP00000000258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]