SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000300 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000300
Domain Number 1 Region: 273-543
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-82
Family Protein kinases, catalytic subunit 0.000000000103
Further Details:      
 
Domain Number 2 Region: 131-304
Classification Level Classification E-value
Superfamily SH2 domain 5.67e-39
Family SH2 domain 0.00000434
Further Details:      
 
Domain Number 3 Region: 76-114
Classification Level Classification E-value
Superfamily SH3-domain 0.00000759
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000300   Gene: ENSMODG00000000247   Transcript: ENSMODT00000000304
Sequence length 550
Comment pep:known_by_projection chromosome:BROADO5:1:398169207:398223393:1 gene:ENSMODG00000000247 transcript:ENSMODT00000000304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPKDPSQRRRSLEPTESVLHSGFSISQTPNKASAPDTHRTPNPPFGTTAPEPKL
FGGFNTSDTVTSPQRSGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVS
QTWFTFRWLQREGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLL
NSENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSL
QQLVAYYSKHADGLCHRLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWM
GTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNK
GSLLDFLKGDMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVA
DFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPY
PGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTST
EPQYQPGENL
Download sequence
Identical sequences F6WR53
ENSMODP00000000300 ENSMODP00000000300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]