SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000341 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000341
Domain Number 1 Region: 29-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000565
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 2 Region: 94-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000194
Family Fibronectin type I module 0.063
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000068
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000341   Gene: ENSMODG00000000285   Transcript: ENSMODT00000000348
Sequence length 382
Comment pep:known_by_projection chromosome:BROADO5:2:42298579:42302784:-1 gene:ENSMODG00000000285 transcript:ENSMODT00000000348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQAARVLAFAVTFFHLARLAFSTCPASCQCPLEVPKCAPGVGLVLDDCRCCKVCAKQL
NEDCSKLQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELTLPNLGCTNPRLVKVAGQCCEEWVCDDDIAKDALDDLDGFVG
KGLEIGASEIELTKNNELIAIGKGGTPLKQLPVFGLEPRIVHGLFHSQKCIVQTTSWSHC
SKTCGTGVSTRVTNDNPQCRLVKETRICEVRPCGQTVYSMFKKGKKCNKTKKSSNPKKFT
FAGCTSLKNYRPKYCGNCLDGRCCTPQQTRTVKVRFRCEDGELVTKNVMMIQSCKCMQSC
PQVPEGTFPFYRLFNDIHKFRD
Download sequence
Identical sequences F6WAV4
13616.ENSMODP00000000341 ENSMODP00000000341 ENSMODP00000000341 XP_007480654.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]