SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000363 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000363
Domain Number 1 Region: 69-160,334-362
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.18e-24
Family Canonical RBD 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000363
Domain Number - Region: 115-284
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.0214
Family beta-Lactamase/D-ala carboxypeptidase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000363   Gene: ENSMODG00000000306   Transcript: ENSMODT00000000370
Sequence length 378
Comment pep:known_by_projection chromosome:BROADO5:3:85535826:85669562:1 gene:ENSMODG00000000306 transcript:ENSMODT00000000370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRANHFCPSVFLLQMNRPIQVKPADSESRGGHDYGRERRTREVNSWLYRWCQRTGFVFL
DHCHGNQKDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKGCAFVKYSSH
AEAQAAINALHGSQTMPGASSSLVVKFADTDKERTMRRMQQMAGQMGMFNPMAIQFGAYG
AYAQAMQQQAAIMASVAQGGYLNPMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPG
ITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQSPTAADPLQQAYAGV
QQYAGPAYPAAYGQISQAFPQPPPMIPQQQREGPEGCNLFIYHLPQEFGDAELMQMFLPF
DEETETQRGEVTCPRSHR
Download sequence
Identical sequences F6WA54
ENSMODP00000000363 ENSMODP00000000363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]