SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000389 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000389
Domain Number 1 Region: 627-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000058
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-39
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-36
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-22
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-19
Family PDZ domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000389   Gene: ENSMODG00000000325   Transcript: ENSMODT00000000397
Sequence length 922
Comment pep:known_by_projection chromosome:BROADO5:4:120861761:121114289:-1 gene:ENSMODG00000000325 transcript:ENSMODT00000000397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNLRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAIQSELGDYDHSENLPGYLSDYSFIPGQ
PQDFEKEVAKLHQQHIGLSPAEAEFNYLNTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILINKNRIRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDERLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHIVHTSPSEVFVNHRSPSSTQANSIILESSPSQENSEDGQPPALPPKQSKKNSWNQINF
SYSQQDLDNHINETFDVPTSPEKSTPNGGIPHDNLVVIKMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTSADLCVPRLNEGDQVVLINGRDIAEHTHDQVVMFIKASCERHSGELVLL
VRPNAVYDVVEEKFENEPDFQYIPEKSPLDGVHQNDNALRESMIQLAEGLDTGTILTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKENDDYINANYINMEIPSSSII
NQYIACQGPLPNTCMDFWQMTWEQGSSVVVMLTTQVERGRVKCHQYWPELTESSSYGNFQ
VTCHSEEGNSAYVFRNITLYNLEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YKFVCEAILKVYEEGFIKPVKT
Download sequence
Identical sequences F6VU58
ENSMODP00000000389 XP_016289073.1.35504 ENSMODP00000000389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]