SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000664 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000664
Domain Number 1 Region: 668-735
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000163
Family Canonical RBD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000664   Gene: ENSMODG00000000549   Transcript: ENSMODT00000000679
Sequence length 795
Comment pep:known_by_projection chromosome:BROADO5:5:204685278:204830263:1 gene:ENSMODG00000000549 transcript:ENSMODT00000000679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWDMCNQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDADGFLGGLKWCSDQS
EIISNQYSNESSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTNDND
ASPSPMPDGTPPTQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANTNHRIRTNPAV
VKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPQTKPTESRNGSKDKCPSKKKP
HLQSQPHHLQAKPTSLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPH
KANQDNPFRTSPKPKSSCKSSVPPSKKPRYSESSGTQVNTPTKKGPEQSELYAQLSKTSG
LSSGQEERKTKRPSLRLFGDHDYCQSINAKTEIRINLSQELQVSRQLEYKDASPGCQGPT
RSSTDPDQCYTRETFQASKQGSPCGHRKQLQDQEIRAELNKHFGHPSQAVFDDEADKTSE
LRNSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFDVSPSCSSF
NSPCRDSVSPPKSLFSQRSQRIHSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYY
ESSHCRHRGHHSSPLYARSRSRSPYSRRPRYDSYEEYQHEKLKREEYRKEYEKRESERAK
QRERQRQKAIEERRVIYVGKIRPDITRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYR
YTCDAFAALENGYTLRRSNEPDFELYFCGRKQYFKSNYADLDSHSDDFDPASTKSKYDSL
DFDSLLKEAQRSLRR
Download sequence
Identical sequences F6XM07
ENSMODP00000000664 ENSMODP00000000664 XP_001362715.1.35504 13616.ENSMODP00000000664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]