SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000751 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000751
Domain Number 1 Region: 323-488,894-1073
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.23e-124
Family Mammalian PLC 0.00000967
Further Details:      
 
Domain Number 2 Region: 645-759
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-31
Family SH2 domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 547-663
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-27
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1092-1213
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-23
Family PLC-like (P variant) 0.0023
Further Details:      
 
Domain Number 5 Region: 792-854
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-19
Family SH3-domain 0.0000285
Further Details:      
 
Domain Number 6 Region: 28-143
Classification Level Classification E-value
Superfamily PH domain-like 7.3e-19
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 7 Region: 156-315
Classification Level Classification E-value
Superfamily EF-hand 0.000000242
Family Calmodulin-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000751
Domain Number - Region: 480-526
Classification Level Classification E-value
Superfamily PH domain-like 0.000179
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000751   Gene: ENSMODG00000000626   Transcript: ENSMODT00000000768
Sequence length 1292
Comment pep:known_by_projection chromosome:BROADO5:1:393644321:393715603:-1 gene:ENSMODG00000000626 transcript:ENSMODT00000000768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMMAGAGAPFANGCGSCAPSEAEVLNLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETR
QITWSRGADKIEGAVDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLK
TLSLQATSEDEVNMWIKGLNWLVTDTTQSATPLQIERWLRKQFYSVDRNREDRISAKDLK
NMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMFSAQKTMDLPFLEAGTL
RGGDRPELCRVSLAEFQQFLLEYQGELWATDRLQVQEFMLNFLRDPLREIEEPYFFLDEF
VTFLFSKENNIWNSQLDLVCVDTMNNPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLR
MGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVTSEYPVILSIEDHCS
IAQQRNMAQYFKKVFGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTS
VMYSENDISNSIKNGILYLEDPINHEWYPHYFVLTSSKIYYSEETNSDQGNDDEEEPKEV
NSSAELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLS
FWRNGKVQHCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLTEPVP
QTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRVQ
QEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGR
NPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQ
LWFPSNYVEEMASPAALEPEREQLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFS
ISMASIAHWSLDVAADSQEDLQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVI
YCRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNKTKGKKFLQYNRLQLSRIYPKGQRL
DSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMSSGRCGYVMQPSNMRDEAFDPFD
KCSLRGIEPCAVCIEVLGARHLPKNGRGIVCPFVEIEVAGADYDNMKHKTEFVVDNGLNP
VWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKTGYRAVPLKNNYSE
DLELASLLIKIDIFPAKENGEVSPFGSSSFRERGSEAPGQLLHGRTREGSFEARYQQPFE
DFRISQEHLADHFDGRERRALRRTRVNGDNRL
Download sequence
Identical sequences F6TAH0
ENSMODP00000000751 ENSMODP00000000751 13616.ENSMODP00000000751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]