SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000763 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000763
Domain Number 1 Region: 194-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-69
Family Protein kinases, catalytic subunit 0.000000159
Further Details:      
 
Domain Number 2 Region: 80-208
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-30
Family SH2 domain 0.00000545
Further Details:      
 
Domain Number 3 Region: 14-101
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000236
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000763   Gene: ENSMODG00000000637   Transcript: ENSMODT00000000780
Sequence length 474
Comment pep:known_by_projection chromosome:BROADO5:3:440020486:440032721:-1 gene:ENSMODG00000000637 transcript:ENSMODT00000000780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVKMPTRRWTPGTQCITKCEHMKPKPGELAFRKGEVVTILEACESKSWYRAKHHESGQE
GLLAAGAVREREAIPTDPKLSLMPWFHGKISGQEAVALLQPAEDGLFLVRESVRHPGDYV
LCVSHGQEVVHYRVLHHGGRLTIDESVCFYNLIDMIEHYMKDKGAICTKLVKPKRKHGTK
SAEEELAKAGWLLNLQQLTLGSQIGEGEPPPGHGHVPAVLQGEYLGQKVAVKNIKCDVTA
QAFLDETAVMTKIQHKNLVRLLGVILHQGLYIVMEYMSKGNLVNFLRTRGRALVHKAQLL
QFSLHVAEGMDYLEGKKLVHRDLAARNILISEDHVAKVSDFGLAKAERRGLDTSRLPVKW
TAPEALKHGKFSSKSDVWSFGILLWEVFSYGRAPYPKMSLKEVSEAVEQGYRMQAPEGCP
ASVYALMASCWEVEPTRRPAFRKLLEKLAKELRSTATEPGPEGSSVGPQGLQEP
Download sequence
Identical sequences F6SUV2
ENSMODP00000000763 ENSMODP00000000763 13616.ENSMODP00000000763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]